BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0445 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 29 0.15 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 29 0.15 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 25 2.5 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 25 2.5 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 25 3.3 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 24 5.8 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 24 5.8 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 7.6 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 7.6 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 23 7.6 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 29.1 bits (62), Expect = 0.15 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 242 VMYLTKLASAWLKCQRTPNCTQSCWSHLLC 331 V Y T L +A C TPN T + WSH C Sbjct: 170 VEYYTVLGAACQVC--TPNATNTVWSHCQC 197 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 29.1 bits (62), Expect = 0.15 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 242 VMYLTKLASAWLKCQRTPNCTQSCWSHLLC 331 V Y T L +A C TPN T + WSH C Sbjct: 170 VEYYTVLGAACQVC--TPNATNTVWSHCQC 197 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 666 TKFGGTNNLFKKKEKFVFMXNYDN 737 + FG L +E FVF+ N+DN Sbjct: 296 SNFGEAWRLLASREAFVFVDNHDN 319 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 25.0 bits (52), Expect = 2.5 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = +1 Query: 358 TVTIRVRQTDKALVESLLGKAQTDYKNKIKKDVVLK----VDTENFLSPDTCGGIELVAA 525 T +R +T+K+L E+L G +QT+ K+ L+ D D G LVA+ Sbjct: 142 TTRLRAERTEKSLKEALEGCSQTETPVNGKRGRNLRSTEEADDAKRAKNDAPSGSSLVAS 201 Query: 526 RG 531 G Sbjct: 202 AG 203 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 24.6 bits (51), Expect = 3.3 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -1 Query: 465 FQHNILLDLILV-VCLGFSEQGLHQSLVGLTDADG--DSGFHELEE 337 ++H + D I VC+ E + S +G +ADG D G ++ + Sbjct: 668 YRHGLPYDQIATWVCIAHRESSYNVSAIGRLNADGSEDHGLFQISD 713 Score = 23.4 bits (48), Expect = 7.6 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 462 QHNILLDLILV-VCLGFSEQGLHQSLVGLTDADGDSGFHEL 343 +H + ++ I VC+ + E + S G +ADG SG H L Sbjct: 192 RHRMPIEQIATWVCIAYHESRFNTSAEGRLNADG-SGDHGL 231 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.8 bits (49), Expect = 5.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -3 Query: 253 QVHYVRDLHELSVPSDELGSACSKIGSSSEVQPASPSFHS 134 Q+H+ H + PS E G+A EV FHS Sbjct: 506 QLHHQMSYHNMFTPSREPGTAWRCRSCGKEVTNRWHHFHS 545 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +3 Query: 342 PAHGTHCHHPRPSNRQGSGG 401 P H TH HH + G GG Sbjct: 230 PTHQTHHHHHHHQHGGGVGG 249 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.8 bits (49), Expect = 5.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -3 Query: 253 QVHYVRDLHELSVPSDELGSACSKIGSSSEVQPASPSFHS 134 Q+H+ H + PS E G+A EV FHS Sbjct: 482 QLHHQMSYHNMFTPSREPGTAWRCRSCGKEVTNRWHHFHS 521 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +3 Query: 342 PAHGTHCHHPRPSNRQGSGG 401 P H TH HH + G GG Sbjct: 278 PTHQTHHHHHHHQHGGGVGG 297 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +3 Query: 342 PAHGTHCHHPRPSNRQGSGG 401 P H TH HH + G GG Sbjct: 278 PTHQTHHHHHHHQHGGGVGG 297 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 208 DELGSACSKIGSS 170 D LGSACS++ SS Sbjct: 72 DSLGSACSQLSSS 84 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 693,044 Number of Sequences: 2352 Number of extensions: 13197 Number of successful extensions: 46 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -