BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0440 (750 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF145615-1|AAD38590.1| 384|Drosophila melanogaster BcDNA.GH0337... 74 2e-13 AE014134-295|AAF51339.1| 384|Drosophila melanogaster CG17712-PA... 74 2e-13 >AF145615-1|AAD38590.1| 384|Drosophila melanogaster BcDNA.GH03377 protein. Length = 384 Score = 73.7 bits (173), Expect = 2e-13 Identities = 36/64 (56%), Positives = 44/64 (68%) Frame = +3 Query: 3 LCKMISALKEAFLPVKEEMDWIKEPVKAAATFEDGQRVQATMEALRQSNEDGCWTSVKLL 182 LCKM+ ALKEAF +E W+K PV AATFEDG VQA +EA+R+SNE W V+L Sbjct: 308 LCKMVGALKEAF--GSKESSWVKAPVSTAATFEDGLYVQAVVEAIRKSNETRQWQRVQLS 365 Query: 183 TEPP 194 T+ P Sbjct: 366 TDSP 369 >AE014134-295|AAF51339.1| 384|Drosophila melanogaster CG17712-PA protein. Length = 384 Score = 73.7 bits (173), Expect = 2e-13 Identities = 36/64 (56%), Positives = 44/64 (68%) Frame = +3 Query: 3 LCKMISALKEAFLPVKEEMDWIKEPVKAAATFEDGQRVQATMEALRQSNEDGCWTSVKLL 182 LCKM+ ALKEAF +E W+K PV AATFEDG VQA +EA+R+SNE W V+L Sbjct: 308 LCKMVGALKEAF--GSKESSWVKAPVSTAATFEDGLYVQAVVEAIRKSNETRQWQRVQLS 365 Query: 183 TEPP 194 T+ P Sbjct: 366 TDSP 369 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,509,520 Number of Sequences: 53049 Number of extensions: 532271 Number of successful extensions: 1373 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1371 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3417159966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -