BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0440 (750 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92813-7|CAB07283.2| 758|Caenorhabditis elegans Hypothetical pr... 29 4.7 Z81030-5|CAB02709.1| 324|Caenorhabditis elegans Hypothetical pr... 28 6.2 >Z92813-7|CAB07283.2| 758|Caenorhabditis elegans Hypothetical protein T28A8.7 protein. Length = 758 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 538 LLSNHLDLSHTWSTIKSISLKNIKIHLVSFKNLL 639 LL+ H DL H + IK L+N ++H+ +L+ Sbjct: 617 LLAEHADLLHDYFAIKLDQLENGRLHITEIPSLV 650 >Z81030-5|CAB02709.1| 324|Caenorhabditis elegans Hypothetical protein C01G10.7 protein. Length = 324 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 15 ISALKEAFLPVKEEMDWIKEPVKAAATFE 101 +S ++E FLP K+ ++W +E V A + E Sbjct: 262 VSVVQEQFLPPKDRIEWAQELVHAYSEHE 290 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,171,471 Number of Sequences: 27780 Number of extensions: 293811 Number of successful extensions: 695 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -