BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0439 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 25 0.85 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 22 6.0 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.6 bits (51), Expect = 0.85 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 330 YAFIKLECIVYFKYYNLMIT 389 YAFI L C+ YF Y ++ T Sbjct: 105 YAFIILLCVYYFYYAFIIFT 124 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 88 RYLQRHER*LQHIHRWNTKLVEHPRISRLHR 180 ++ HE LQH+H+ E ++ LH+ Sbjct: 102 KFNPHHEIKLQHLHQSKFNPHEEVKLQHLHQ 132 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,309 Number of Sequences: 336 Number of extensions: 2926 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -