BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0438 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 2.1 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 23 2.1 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 4.9 M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-... 22 6.4 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 6.4 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 6.4 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 6.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 6.4 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 8.5 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +1 Query: 619 IWCSSCSKYIIVGNVTKAILSN 684 +W SSCS ++ + + A+++N Sbjct: 278 VWMSSCSVFVFLSLMEFAVVNN 299 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 122 GCAMVDSCSNILTGDQ 169 G M+DSCSN+ + D+ Sbjct: 106 GVEMIDSCSNVDSSDK 121 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.2 bits (45), Expect = 4.9 Identities = 15/52 (28%), Positives = 20/52 (38%) Frame = +1 Query: 295 DRRDPSKPQRRLLRYHDTSDPMGTKPTYRD*SQELRAVERKVLRRXKPCMLG 450 D R K + LLR D+ D + TY A V + C+LG Sbjct: 63 DGRVGGKRRNILLRRTDSMDSQNSASTYNSFLSSDSASSGNVYCKCDDCLLG 114 >M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H40. ). Length = 74 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 335 VTMTQVIQWVQNPRTVTEAKN 397 +T TQV W QN RT + +N Sbjct: 47 LTETQVKIWFQNRRTKWKKQN 67 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 323 RCGFEGSRLSNTRKLPKIQGCFSTKLHGNKVLK 225 R GFE R + L ++ CF L G++ K Sbjct: 169 RTGFEHKRQPTSIDLNAVRLCFQVFLEGSQKRK 201 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 323 RCGFEGSRLSNTRKLPKIQGCFSTKLHGNKVLK 225 R GFE R + L ++ CF L G++ K Sbjct: 169 RTGFEHKRQPTSIDLNAVRLCFQVFLEGSQKRK 201 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -3 Query: 671 ALVTLPTIMYF 639 AL+TLPTI +F Sbjct: 327 ALITLPTIFWF 337 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 640 KYIIVGNVTKAILSN 684 KY ++GN TK I+ N Sbjct: 449 KYDLIGNGTKLIIKN 463 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 644 YFEQLLHQININ 609 YFEQ L+++N N Sbjct: 48 YFEQTLNELNFN 59 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,768 Number of Sequences: 438 Number of extensions: 4734 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -