BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0437 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 2.3 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 24 4.0 AF457563-1|AAL68793.1| 48|Anopheles gambiae hypothetical prote... 24 5.3 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 7.0 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 23 9.2 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -3 Query: 116 VNRLHSNGHNHILWKSLSTVYLYQSQELPTRRLLE 12 V RLH + H +I W S L + E+ R+L+ Sbjct: 332 VTRLHQDPHRNIFWWSPLLARLRNNCEVARDRMLQ 366 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 24.2 bits (50), Expect = 4.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 101 SAGDLLREERQRPGSEYGEMIEEKIRNGEI 190 S GD L E+RQR + E+ E IRN ++ Sbjct: 233 SHGDRLLEDRQRFDNYKRELKETMIRNQQL 262 >AF457563-1|AAL68793.1| 48|Anopheles gambiae hypothetical protein 16 protein. Length = 48 Score = 23.8 bits (49), Expect = 5.3 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 420 SSLRPLPAAPRLKHLSVHISR 358 ++L P PA PRL HL + I R Sbjct: 28 TTLTP-PAPPRLSHLGITIGR 47 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.4 bits (48), Expect = 7.0 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 198 WRLLAPYYTRPCRNPVK 248 W+L PY T P P K Sbjct: 640 WQLPPPYVTEPVEGPAK 656 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 23 FVLGAPGSGKGTQCSMISKEYDYVHLS 103 F+LG + +C +I+ Y+HLS Sbjct: 239 FILGVQATRNVIRCELIALLLHYLHLS 265 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 712,888 Number of Sequences: 2352 Number of extensions: 14730 Number of successful extensions: 31 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -