BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0437 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.8 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.5 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 8.5 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +3 Query: 270 FRVIKIIWMAGSASCPTKPSYFSFCSSNVRVRY 368 F VIK+ +G+ P + +SN+R+ + Sbjct: 940 FNVIKLTKTSGTVQAQINPDFAFIVNSNLRLTF 972 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +2 Query: 329 LLFVLFFEC 355 LLF++FFEC Sbjct: 455 LLFLMFFEC 463 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +2 Query: 329 LLFVLFFEC 355 LLF++FFEC Sbjct: 508 LLFLMFFEC 516 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = +2 Query: 35 APGSGKGTQCSMIS 76 +P + KG++CSMI+ Sbjct: 275 SPATPKGSKCSMIT 288 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,565 Number of Sequences: 438 Number of extensions: 4407 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -