Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0434
         (472 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.9  

>SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1068

 Score = 27.5 bits (58), Expect = 5.9
 Identities = 13/57 (22%), Positives = 28/57 (49%)
 Frame = -2

Query: 420  YPFVFIYHSLFLSETILLQSLQNSVKREPADIQDVFIQSQFIRIFLLFAQFNLPECW 250
            Y F ++Y S+     + + +  ++    P  +  +++Q+ F  +  L   F +PECW
Sbjct: 905  YVFKWMYDSM--PPFLRVVTCSSTADCYPPALTMLYLQTAFYAVAALVNAFRIPECW 959


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,442,213
Number of Sequences: 59808
Number of extensions: 225851
Number of successful extensions: 346
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 333
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 346
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 982083920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)