BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brP-0434
(472 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
U41270-5|AAA82442.2| 364|Caenorhabditis elegans Hypothetical pr... 29 1.3
>U41270-5|AAA82442.2| 364|Caenorhabditis elegans Hypothetical
protein AH9.4 protein.
Length = 364
Score = 29.5 bits (63), Expect = 1.3
Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
Frame = -2
Query: 321 DVFIQSQFIRIFLL--FAQFNLPECW*LTLDYIVIVYNIHLFTE*TFKLLS*TRRYAFHV 148
DVF +S F + LL F + +P +TLD++V+++ F+ ++ RRYA
Sbjct: 163 DVFHESAFKHVHLLDIFLFYAIPSLLRITLDFLVLIHCYSPFSVEGLDRVTIDRRYAISG 222
Query: 147 QTTPFR 130
T R
Sbjct: 223 PATTKR 228
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,498,507
Number of Sequences: 27780
Number of extensions: 178389
Number of successful extensions: 384
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 375
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 384
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 850313440
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -