BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0432 (625 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0129 + 17520753-17520842,17521651-17521741,17521887-175220... 161 3e-40 01_06_1208 + 35424241-35424370,35424415-35424728,35424782-354249... 28 6.9 03_02_0901 + 12267042-12267182,12267949-12268095,12268163-122682... 27 9.2 >03_04_0129 + 17520753-17520842,17521651-17521741,17521887-17522070, 17522149-17522224 Length = 146 Score = 161 bits (392), Expect = 3e-40 Identities = 70/130 (53%), Positives = 98/130 (75%) Frame = +2 Query: 131 TVKDVEQDKIVKTVAAHLKKTGKVKVPXHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 310 TVKDV + VK +AHLK++GK+++P +D+VKTARFKEL PYDPDW+Y R A+I R I Sbjct: 8 TVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDPDWYYTRAASIARKI 67 Query: 311 YIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARXALQSLEALKLVEKVQDGGRILT 490 Y+R +GV KI+GGR+RNG P HFC+SSG+I+R LQ L+ + +++ GGR++T Sbjct: 68 YLRQGIGVGGFQKIYGGRQRNGSRPPHFCKSSGAISRNILQQLQKMGIIDVDPKGGRLIT 127 Query: 491 TQXRRDLDRI 520 +Q RRDLD++ Sbjct: 128 SQGRRDLDQV 137 >01_06_1208 + 35424241-35424370,35424415-35424728,35424782-35424967, 35425361-35425523,35425601-35425787,35425875-35426016 Length = 373 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 476 HRLELSQQASMPPTIAKXCVQYCLMTCRN 390 H + + + P TIA+ +QYCL TC N Sbjct: 116 HPTQDPEATNSPFTIAQLQLQYCLHTCTN 144 >03_02_0901 + 12267042-12267182,12267949-12268095,12268163-12268253, 12268367-12268485,12268779-12268969,12269440-12269650, 12270072-12270309,12270944-12271329,12271933-12271956, 12271984-12272077,12272341-12272525,12273025-12273255, 12273665-12273730,12273816-12274034,12274764-12275003, 12275244-12275423,12276269-12276535,12276612-12276815, 12276896-12277048 Length = 1128 Score = 27.5 bits (58), Expect = 9.2 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +2 Query: 149 QDKIVKTVAAHLKKTGKVKVPXHMDLVKTARFKELAPYDPDWFYVRCAAILRHIY 313 +D+I+ + ++ V+VP + +LV TA L P D W +R A LR + Sbjct: 947 EDRILMSDIVFMRAWVNVEVPTYCNLVTTA----LQPQDETWQGMRTTAELRRAH 997 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,109,868 Number of Sequences: 37544 Number of extensions: 259957 Number of successful extensions: 611 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1513903616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -