BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0431 (750 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1734.13 |atp3||F1-ATPase gamma subunit |Schizosaccharomyces ... 26 5.0 SPAC23A1.06c |cmk2|mkp2|MAPK-activated protein kinase Cmk2|Schiz... 25 8.7 SPAC26H5.04 |||vacuolar import and degradation protein Vid28|Sch... 25 8.7 >SPBC1734.13 |atp3||F1-ATPase gamma subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 301 Score = 26.2 bits (55), Expect = 5.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 574 RLDPCVRXVSYRGKSYSNACPTTRRKV 654 R+ PC+ V +RG S+ C T +++ Sbjct: 11 RMRPCISVVGFRGFHASSPCEATLKEI 37 >SPAC23A1.06c |cmk2|mkp2|MAPK-activated protein kinase Cmk2|Schizosaccharomyces pombe|chr 1|||Manual Length = 504 Score = 25.4 bits (53), Expect = 8.7 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 Query: 11 IEALLGMGSSVILAGDLNCKHIRWNSHTTTPNG 109 +E + G IL D + WNS T TP G Sbjct: 223 LEGIGAGGIGRILIADFGFSKVVWNSKTATPCG 255 >SPAC26H5.04 |||vacuolar import and degradation protein Vid28|Schizosaccharomyces pombe|chr 1|||Manual Length = 729 Score = 25.4 bits (53), Expect = 8.7 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = +2 Query: 35 SSVILAGDLNCKHIRWNSHTTTPN--GRRLDALVDDLAFDIVAPLTPTHYPLNIAHRPDI 208 S ++LAG C +I W T+P+ + +++ +L F + H ++ R + Sbjct: 661 SEILLAGIWLCINILWPKQCTSPSQEDKERASILQNLGFGECLQMLQNHSSPDVRER--V 718 Query: 209 LDIALLKNVT 238 D + NVT Sbjct: 719 KDALMYINVT 728 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,776,904 Number of Sequences: 5004 Number of extensions: 50474 Number of successful extensions: 130 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -