BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0430 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 26 1.4 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 25 3.3 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 25 3.3 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 25 3.3 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 25 3.3 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 25 3.3 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 25 3.3 AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 23 7.6 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 7.6 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 7.6 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 4 NSYVTSPICCPSRASLLTG 60 N++ +C PSR S+LTG Sbjct: 71 NAFAQQALCAPSRNSMLTG 89 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 3.3 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -2 Query: 620 HRVLYTWSXSGSIASGNGDXGMRSSQXLSSAMILKLGLFTTVTLLNAS 477 HR L WS + +G M +S IL + ++TT+ + +A+ Sbjct: 16 HRNLADWSYYANETAGEEYYEMPIDMRFNSGHILSIMVYTTLMVFSAT 63 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 24.6 bits (51), Expect = 3.3 Identities = 9/16 (56%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Frame = -3 Query: 94 YCS-RSCGCERTCLSA 50 YC R+C CE+ CL+A Sbjct: 59 YCKYRTCHCEKCCLTA 74 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 24.6 bits (51), Expect = 3.3 Identities = 9/16 (56%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Frame = -3 Query: 94 YCS-RSCGCERTCLSA 50 YC R+C CE+ CL+A Sbjct: 59 YCKYRTCHCEKCCLTA 74 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 24.6 bits (51), Expect = 3.3 Identities = 9/16 (56%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Frame = -3 Query: 94 YCS-RSCGCERTCLSA 50 YC R+C CE+ CL+A Sbjct: 59 YCKYRACQCEKCCLTA 74 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 24.6 bits (51), Expect = 3.3 Identities = 9/16 (56%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Frame = -3 Query: 94 YCS-RSCGCERTCLSA 50 YC R+C CE+ CL+A Sbjct: 59 YCKYRACQCEKCCLTA 74 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 3.3 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -2 Query: 620 HRVLYTWSXSGSIASGNGDXGMRSSQXLSSAMILKLGLFTTVTLLNAS 477 HR L WS + +G M +S IL + ++TT+ + +A+ Sbjct: 16 HRNLADWSYYANETAGEEYYEMPIDMRFNSGHILSIMVYTTLMVFSAT 63 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 252 RAGQNGAAWSGIQFTTTILC 311 R +GA G++FTTT+ C Sbjct: 123 RLAGDGAVTYGMRFTTTLAC 142 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.4 bits (48), Expect = 7.6 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -3 Query: 277 QAAPFCPARGYHLWATGFFSTILIQIFPRIERVISGFLKYSSERLFTRDI 128 QA P C L A GF + + P +ER + GF ++L D+ Sbjct: 226 QAMPMC-----RLVARGFTACAEAYLTPHVERYLDGFRSGFRDQLRGADV 270 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.4 bits (48), Expect = 7.6 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -3 Query: 277 QAAPFCPARGYHLWATGFFSTILIQIFPRIERVISGFLKYSSERLFTRDI 128 QA P C L A GF + + P +ER + GF ++L D+ Sbjct: 226 QAMPMC-----RLVARGFTACAEAYLTPHVERYLDGFRSGFRDQLRGADV 270 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 730,239 Number of Sequences: 2352 Number of extensions: 13504 Number of successful extensions: 56 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -