BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0430 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 25 0.76 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 5.3 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 5.3 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 7.1 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 7.1 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 25.0 bits (52), Expect = 0.76 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +1 Query: 274 LGREFSLLQLYFVQQTVCRRFRL 342 +GR++++L+L V T+ R FR+ Sbjct: 489 VGRKYAMLKLKIVLSTILRNFRV 511 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 252 RAGQNGAAWSGIQFTTTILC 311 R +G+ G++FTTT+ C Sbjct: 142 RLSGDGSVTYGMRFTTTLAC 161 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 5.3 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = -2 Query: 302 SCSKLNSRPSRAILSSPGVPPLGHRXL*YHTDSNISPH 189 +C PS A P P H YH SPH Sbjct: 298 ACHSPGVYPSTAGFLPPSYHPHQHHPSQYHPHRGSSPH 335 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +3 Query: 246 YPRAGQNGAAWSGIQFTTTILCPTN 320 Y R NG+ I+ + T+ CP N Sbjct: 139 YIRIFPNGSVLYSIRISLTLSCPMN 163 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +3 Query: 246 YPRAGQNGAAWSGIQFTTTILCPTN 320 Y R NG+ I+ + T+ CP N Sbjct: 139 YIRIFPNGSVLYSIRISLTLSCPMN 163 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,224 Number of Sequences: 438 Number of extensions: 4159 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -