BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0427 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57500.1 68418.m07185 expressed protein 29 4.4 At5g09350.1 68418.m01083 phosphatidylinositol 4-kinase, putative... 28 5.8 >At5g57500.1 68418.m07185 expressed protein Length = 318 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -1 Query: 528 NQAAGRKTHVKSI-CNITKEHSSLIPHNVGKGQEDDYVLLNCNQ 400 N G K VK + CN+TKE ++ + + DD ++LNCN+ Sbjct: 96 NVPDGVKVDVKFVFCNLTKEDQKVLVA-LEIMRYDDIIILNCNE 138 >At5g09350.1 68418.m01083 phosphatidylinositol 4-kinase, putative strong similarity to gi:4467359 Length = 1116 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = -1 Query: 432 EDDYVLLNCNQTAP*NNSLKVIKA*NTQTGSKCWQKNMESSR 307 ED+YVLLN + P ++V+KA T G+K +++ S+ Sbjct: 616 EDEYVLLNSREKVPYMICVEVLKA-ETPCGAKTTSTSLKLSK 656 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,903,635 Number of Sequences: 28952 Number of extensions: 336276 Number of successful extensions: 718 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 716 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -