BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0426 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54990.1 68416.m06102 AP2 domain-containing transcription fac... 30 1.7 At5g61950.1 68418.m07776 ubiquitin carboxyl-terminal hydrolase-r... 29 3.0 At3g12810.1 68416.m01598 SNF2 domain-containing protein / helica... 29 3.0 At3g07740.2 68416.m00935 transcriptional adaptor (ADA2a) identic... 29 3.0 At3g07740.1 68416.m00936 transcriptional adaptor (ADA2a) identic... 29 3.0 At5g23910.1 68418.m02808 kinesin motor protein-related 29 3.9 At5g55540.1 68418.m06919 expressed protein 28 5.2 At1g67170.1 68414.m07641 expressed protein similar to enterophil... 28 5.2 At1g07250.1 68414.m00771 UDP-glucoronosyl/UDP-glucosyl transfera... 28 5.2 At5g23440.1 68418.m02750 ferredoxin-thioredoxin reductase, putat... 28 6.8 At4g01090.1 68417.m00147 extra-large G-protein-related contains ... 28 6.8 At3g44290.1 68416.m04756 no apical meristem (NAM) family protein... 27 9.0 >At3g54990.1 68416.m06102 AP2 domain-containing transcription factor, putative similar to (SP:P47927) Floral homeotic protein APETALA2, Arabidopsis thaliana, U12546 Length = 247 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +1 Query: 28 YDRYLTEYEH-DIDRQNVQNTFRHDWQKRDAVEESQILAVLRAFSKRFGRHQSRGK 192 YDR ++ D D V + +RHD K + + + + LR S FGR S+ K Sbjct: 161 YDRAAIKFRGLDADINFVVDDYRHDIDKMKNLNKVEFVQTLRRESASFGRGSSKYK 216 >At5g61950.1 68418.m07776 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1132 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 502 QPVDGSQPVEMVLPCLVGVEGINSTSHASWHVVDWPVIIERAR 374 +PVD VEM+ L V+ S S W +WP+ ++ R Sbjct: 298 EPVDAVAAVEMIKNQLADVKAFASKSKNGWS-YEWPLAVDEER 339 >At3g12810.1 68416.m01598 SNF2 domain-containing protein / helicase domain-containing protein similar to transcriptional activator SRCAP [Homo sapiens] GI:5106572; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2055 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +2 Query: 548 ITDLTAPLIDPLKPKSLKXIEYEPDNK 628 +TDL +PL+ P++P ++ Y PD + Sbjct: 1042 VTDLLSPLLSPIRPAIVRRQVYFPDRR 1068 >At3g07740.2 68416.m00935 transcriptional adaptor (ADA2a) identical to transcriptional adaptor ADA2a [Arabidopsis thaliana] gi|13591698|gb|AAK31319 Length = 477 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 22 FNYDRYLTEYEHDIDRQNVQNTFRHDWQKRDAVEESQILAVLRAFSKRFGRHQSR 186 +N R E EHD D + + DA E Q L VLR +SKR + R Sbjct: 204 YNLKREEFEIEHDNDAEQLLADMEFKDSDTDA-EREQKLQVLRIYSKRLDERKRR 257 >At3g07740.1 68416.m00936 transcriptional adaptor (ADA2a) identical to transcriptional adaptor ADA2a [Arabidopsis thaliana] gi|13591698|gb|AAK31319 Length = 548 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 22 FNYDRYLTEYEHDIDRQNVQNTFRHDWQKRDAVEESQILAVLRAFSKRFGRHQSR 186 +N R E EHD D + + DA E Q L VLR +SKR + R Sbjct: 275 YNLKREEFEIEHDNDAEQLLADMEFKDSDTDA-EREQKLQVLRIYSKRLDERKRR 328 >At5g23910.1 68418.m02808 kinesin motor protein-related Length = 665 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 252 SRFTTTLSLPLRGLRYPATVTCLSIARSTATPRALSMPTTTLAL 383 S+ T L L+G +TCL++ R T R + T T A+ Sbjct: 261 SKLTRMLKDCLKGSNITLLITCLTVLRGNVTERKTKINTATSAI 304 >At5g55540.1 68418.m06919 expressed protein Length = 1380 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = -2 Query: 225 SGKTLRRVGLYLSSALMSSEPFRE----RTKDCQNLA 127 SGKT+ R G L+ L+S + FRE R D NLA Sbjct: 1057 SGKTVLRAGFDLARNLLSDDDFREVLQRRYHDLHNLA 1093 >At1g67170.1 68414.m07641 expressed protein similar to enterophilin-2L (GI:12718845) [Cavia porcellus]; similar to Hyaluronan mediated motility receptor (Intracellular hyaluronic acid binding protein) (Receptor for hyaluronan-mediated motility) (CD168 antigen) (Swiss-Prot:O75330) [Homo sapiens] Length = 359 Score = 28.3 bits (60), Expect = 5.2 Identities = 19/80 (23%), Positives = 33/80 (41%) Frame = +2 Query: 95 MIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRRSVFPELLSTYPYSKSIYDDPI 274 ++ R E SK + Q +S + I A R + + +TY Y K Y+D + Sbjct: 150 VVAREELMSKVHQLTQELQKSRSDVQQIPALMSELENLRQEYQQCRATYDYEKKFYNDHL 209 Query: 275 AAAERITVPGYRYLPVHREI 334 E + Y+ + RE+ Sbjct: 210 ---ESLQAMEKNYMTMAREV 226 >At1g07250.1 68414.m00771 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP-glucose glucosyltransferase GI:453245 from [Manihot esculenta] Length = 479 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = -1 Query: 442 GINSTSHASWH---VVDWPVIIERARVVVGIDRARGVAVDLAMD 320 G NST + W V WP+ E+ + + G+AVDL MD Sbjct: 369 GWNSTLESLWFGVPVATWPMYAEQQLNAFTLVKELGLAVDLRMD 412 >At5g23440.1 68418.m02750 ferredoxin-thioredoxin reductase, putative similar to ferredoxin-thioredoxin reductase, variable chain (FTR-V, Ferredoxin- thioredoxin reductase subunit A, FTR-A) [Zea mays] SWISS-PROT:P80680 Length = 182 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +3 Query: 291 LRYPATVTCLSIARSTATPRALSMPTTTLA-LSIITGQS 404 +R P++ CLS + +TAT +++ + +A LS+ T QS Sbjct: 15 IRRPSSHDCLSASATTATATPMALKSCIVAPLSLFTSQS 53 >At4g01090.1 68417.m00147 extra-large G-protein-related contains weak similarity to extra-large G-protein [Arabidopsis thaliana] gi|3201682|gb|AAC19353 Length = 714 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 317 PVHREIYG-YSPRPIYAHNYPRSLDYYRPIY 406 PVH + ++P P Y H YP + Y P++ Sbjct: 116 PVHLHGHANHNPGPSYYHQYPEPIQYPGPVH 146 >At3g44290.1 68416.m04756 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; NAC2 - Arabidopsis thaliana, EMBL:AF201456 Length = 335 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 460 CLVGVEGINSTSHASWHVVDWPVII 386 C +G+ I S + A W VV W +++ Sbjct: 302 CFIGIYSIKSINRARWDVVVWLLVM 326 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,464,923 Number of Sequences: 28952 Number of extensions: 302513 Number of successful extensions: 917 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 916 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -