BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0425 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 27 0.25 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 27 0.25 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 24 1.3 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 24 1.3 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 24 1.8 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 26.6 bits (56), Expect = 0.25 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 246 EWPFDIRRRTRLFVRTPCFI 187 EWP +R+R LF+ CF+ Sbjct: 406 EWPRLLRKRKELFIAIVCFV 425 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 26.6 bits (56), Expect = 0.25 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 246 EWPFDIRRRTRLFVRTPCFI 187 EWP +R+R LF+ CF+ Sbjct: 459 EWPRLLRKRKELFIAIVCFV 478 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 181 SLLVVAASDTKYIAFPFIA*LISXYF 104 S+ V+ DTKY+ FP I + YF Sbjct: 145 SIAVLYRPDTKYMKFPAIYEIYPNYF 170 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 181 SLLVVAASDTKYIAFPFIA*LISXYF 104 S+ V+ DTKY+ FP I + YF Sbjct: 145 SIAVLYRPDTKYMKFPAIYEIYPNYF 170 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.8 bits (49), Expect = 1.8 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = -2 Query: 179 LACRCRQRHEVHSLSIHRLTDQXLLRRP-CAFRKRNEACARPPLRTTSGXPVAGXETFT 6 ++ R RH VHSL+ + + LL+R C RK R + P++ T Sbjct: 52 ISSRRNGRHNVHSLAFGAIQLRQLLKRQLCEKRKEVSIITEDSSRKQTIDPLSSNTQIT 110 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,689 Number of Sequences: 438 Number of extensions: 3512 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -