BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0422 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.8 AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding prote... 21 8.5 AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding prote... 21 8.5 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.0 bits (47), Expect = 2.8 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 Query: 198 YQMHLDSWGW 227 +Q HLD W W Sbjct: 620 HQQHLDQWNW 629 >AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding protein ASP6 protein. Length = 146 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = +3 Query: 12 IYLTNVFIKFKHVLSXQEYFSSCYAGISTCWKGCTHKFG 128 + L + F+K ++ +EY + + TC K T G Sbjct: 86 VILWDFFVKNARMILLEEYIPRVESVVETCKKEVTSTEG 124 >AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding protein protein. Length = 120 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = +3 Query: 12 IYLTNVFIKFKHVLSXQEYFSSCYAGISTCWKGCTHKFG 128 + L + F+K ++ +EY + + TC K T G Sbjct: 60 VILWDFFVKNARMILLEEYIPRVESVVETCKKEVTSTEG 98 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,447 Number of Sequences: 438 Number of extensions: 3813 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -