BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0419 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 24 1.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.6 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.8 bits (49), Expect = 1.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +2 Query: 386 LKLFMQT*FTASWTRNVNVWKW 451 +K+F + A W+ N +W W Sbjct: 391 MKVFEELLLDADWSVNAGMWMW 412 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 Query: 448 VDVALGRXARLEDAASIADVLADWCNACEAVLN 546 VDV+ R LED D W N A L+ Sbjct: 456 VDVSTKRRTELEDLTPTFDFTNGWANGTLAKLS 488 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,544 Number of Sequences: 336 Number of extensions: 3336 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -