BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0411 (534 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF231056-1|AAG33967.1| 2285|Homo sapiens BRG1-Associated Factor ... 31 1.9 AB001895-1|BAA23269.1| 1142|Homo sapiens B120 protein. 31 1.9 S73849-1|AAB31735.1| 873|Homo sapiens very low density lipoprot... 29 7.8 L22431-1|AAA61344.1| 873|Homo sapiens very low density lipoprot... 29 7.8 L20470-1|AAA53684.1| 873|Homo sapiens very low density lipoprot... 29 7.8 D16532-1|BAA03969.1| 873|Homo sapiens very low density lipoprot... 29 7.8 D16494-1|BAA03946.1| 845|Homo sapiens very low density lipoprot... 29 7.8 D16493-1|BAA03945.1| 873|Homo sapiens very low density lipoprot... 29 7.8 DQ067198-1|AAY46157.1| 873|Homo sapiens very low density lipopr... 29 7.8 BC142653-1|AAI42654.1| 845|Homo sapiens very low density lipopr... 29 7.8 BC007412-1|AAH07412.1| 193|Homo sapiens chromosome 14 open read... 29 7.8 AL450467-3|CAH72455.1| 845|Homo sapiens very low density lipopr... 29 7.8 AL450467-2|CAH72454.1| 873|Homo sapiens very low density lipopr... 29 7.8 AL450467-1|CAH72452.1| 173|Homo sapiens very low density lipopr... 29 7.8 AK223103-1|BAD96823.1| 193|Homo sapiens chromosome 14 open read... 29 7.8 AK223092-1|BAD96812.1| 193|Homo sapiens chromosome 14 open read... 29 7.8 AB208822-1|BAD92059.1| 555|Homo sapiens Very low-density lipopr... 29 7.8 >AF231056-1|AAG33967.1| 2285|Homo sapiens BRG1-Associated Factor 250a protein. Length = 2285 Score = 31.5 bits (68), Expect = 1.9 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 265 SPDFRGGRGMSESNRLPPIAQQPASKPRMRQSS 167 S + G+G+ + +LPP QPAS+P+ Q S Sbjct: 1390 SVPYSTGQGLPQQQQLPPAQPQPASQPQAAQPS 1422 >AB001895-1|BAA23269.1| 1142|Homo sapiens B120 protein. Length = 1142 Score = 31.5 bits (68), Expect = 1.9 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 265 SPDFRGGRGMSESNRLPPIAQQPASKPRMRQSS 167 S + G+G+ + +LPP QPAS+P+ Q S Sbjct: 1007 SVPYSTGQGLPQQQQLPPAQPQPASQPQAAQPS 1039 >S73849-1|AAB31735.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 313 CLNLQAIPSRWKCQG 357 C N Q +PSRWKC G Sbjct: 79 CNNGQCVPSRWKCDG 93 >L22431-1|AAA61344.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 313 CLNLQAIPSRWKCQG 357 C N Q +PSRWKC G Sbjct: 79 CNNGQCVPSRWKCDG 93 >L20470-1|AAA53684.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 313 CLNLQAIPSRWKCQG 357 C N Q +PSRWKC G Sbjct: 79 CNNGQCVPSRWKCDG 93 >D16532-1|BAA03969.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 313 CLNLQAIPSRWKCQG 357 C N Q +PSRWKC G Sbjct: 79 CNNGQCVPSRWKCDG 93 >D16494-1|BAA03946.1| 845|Homo sapiens very low density lipoprotein receptor protein. Length = 845 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 313 CLNLQAIPSRWKCQG 357 C N Q +PSRWKC G Sbjct: 79 CNNGQCVPSRWKCDG 93 >D16493-1|BAA03945.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 313 CLNLQAIPSRWKCQG 357 C N Q +PSRWKC G Sbjct: 79 CNNGQCVPSRWKCDG 93 >DQ067198-1|AAY46157.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 313 CLNLQAIPSRWKCQG 357 C N Q +PSRWKC G Sbjct: 79 CNNGQCVPSRWKCDG 93 >BC142653-1|AAI42654.1| 845|Homo sapiens very low density lipoprotein receptor protein. Length = 845 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 313 CLNLQAIPSRWKCQG 357 C N Q +PSRWKC G Sbjct: 79 CNNGQCVPSRWKCDG 93 >BC007412-1|AAH07412.1| 193|Homo sapiens chromosome 14 open reading frame 153 protein. Length = 193 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = -3 Query: 373 GIAKICPDISTAKEWLEG*DRNSRLQPDRLFFVRRKSP 260 G+++ CP + +W+ D+ S L+P + +SP Sbjct: 41 GVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESP 78 >AL450467-3|CAH72455.1| 845|Homo sapiens very low density lipoprotein receptor protein. Length = 845 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 313 CLNLQAIPSRWKCQG 357 C N Q +PSRWKC G Sbjct: 79 CNNGQCVPSRWKCDG 93 >AL450467-2|CAH72454.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 313 CLNLQAIPSRWKCQG 357 C N Q +PSRWKC G Sbjct: 79 CNNGQCVPSRWKCDG 93 >AL450467-1|CAH72452.1| 173|Homo sapiens very low density lipoprotein receptor protein. Length = 173 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 313 CLNLQAIPSRWKCQG 357 C N Q +PSRWKC G Sbjct: 79 CNNGQCVPSRWKCDG 93 >AK223103-1|BAD96823.1| 193|Homo sapiens chromosome 14 open reading frame 153 variant protein. Length = 193 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = -3 Query: 373 GIAKICPDISTAKEWLEG*DRNSRLQPDRLFFVRRKSP 260 G+++ CP + +W+ D+ S L+P + +SP Sbjct: 41 GVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESP 78 >AK223092-1|BAD96812.1| 193|Homo sapiens chromosome 14 open reading frame 153 variant protein. Length = 193 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = -3 Query: 373 GIAKICPDISTAKEWLEG*DRNSRLQPDRLFFVRRKSP 260 G+++ CP + +W+ D+ S L+P + +SP Sbjct: 41 GVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESP 78 >AB208822-1|BAD92059.1| 555|Homo sapiens Very low-density lipoprotein receptor precursor variant protein. Length = 555 Score = 29.5 bits (63), Expect = 7.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 313 CLNLQAIPSRWKCQG 357 C N Q +PSRWKC G Sbjct: 136 CNNGQCVPSRWKCDG 150 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,805,811 Number of Sequences: 237096 Number of extensions: 1436018 Number of successful extensions: 2912 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 2727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2912 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5216942984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -