BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0411 (534 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 25 0.64 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 25 0.64 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 25 0.64 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 25 0.64 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 25 0.64 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 24 1.1 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 1.5 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 2.0 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 2.0 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 2.0 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 2.0 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 23 2.0 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 23 2.0 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 2.0 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 23 2.0 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 23 2.0 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 23 2.0 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 23 2.0 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 23 2.0 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 23 2.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 2.0 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 3.4 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 3.4 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 3.4 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 3.4 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 3.4 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 3.4 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 3.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 4.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.9 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 24.6 bits (51), Expect = 0.64 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPPDKKKSIR 295 G W+ S Q R RH PST RF P +R Sbjct: 129 GSWI-SIQEQIPRFRHIGPSTPFPRFIPPNAYRLR 162 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 24.6 bits (51), Expect = 0.64 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPPDKKKSIR 295 G W+ S Q R RH PST RF P +R Sbjct: 129 GSWI-SIQEQIPRFRHIGPSTPFPRFIPPNAYRLR 162 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 24.6 bits (51), Expect = 0.64 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPPDKKKSIR 295 G W+ S Q R RH PST RF P +R Sbjct: 129 GSWI-SIQEQIPRFRHIGPSTPFPRFIPPNAYRLR 162 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 24.6 bits (51), Expect = 0.64 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPPDKKKSIR 295 G W+ S Q R RH PST RF P +R Sbjct: 129 GSWI-SIQEQIPRFRHIGPSTPFPRFIPPNAYRLR 162 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 24.6 bits (51), Expect = 0.64 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPPDKKKSIR 295 G W+ S Q R RH PST RF P +R Sbjct: 129 GSWI-SIQEQIPRFRHIGPSTPFPRFIPPNAYRLR 162 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.8 bits (49), Expect = 1.1 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPPDKKKSIR 295 G W+ S Q R RH PST RF P +R Sbjct: 129 GSWI-SIQEQIPRFRHIGPSTLFPRFIPPNAYRLR 162 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 1.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 363 GPWI-SIQEQIPRFRHIGPSTSFPRFIP 389 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 140 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 166 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 140 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 166 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 140 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 166 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 140 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 166 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 132 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 158 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 132 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 158 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 132 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 158 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 132 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 158 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 138 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 164 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 135 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 161 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 135 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 161 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 135 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 161 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 135 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 161 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.0 bits (47), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 191 GCWLLSDWRQSVRLRHAPPSTEVRRFPP 274 G W+ S Q R RH PST RF P Sbjct: 365 GPWI-SIQEQIPRFRHIGPSTPFPRFIP 391 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 218 QSVRLRHAPPSTEVRRF-PPDKKK 286 Q R RH PST RF PP+ K Sbjct: 146 QIPRFRHIGPSTPFPRFIPPNAYK 169 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 218 QSVRLRHAPPSTEVRRF-PPDKKK 286 Q R RH PST RF PP+ K Sbjct: 146 QIPRFRHIGPSTPFPRFIPPNAYK 169 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 218 QSVRLRHAPPSTEVRRF-PPDKKK 286 Q R RH PST RF PP+ K Sbjct: 146 QIPRFRHIGPSTPFPRFIPPNAYK 169 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 218 QSVRLRHAPPSTEVRRF-PPDKKK 286 Q R RH PST RF PP+ K Sbjct: 146 QIPRFRHIGPSTPFPRFIPPNAYK 169 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 218 QSVRLRHAPPSTEVRRF-PPDKKK 286 Q R RH PST RF PP+ K Sbjct: 146 QIPRFRHIGPSTPFPRFIPPNAYK 169 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 218 QSVRLRHAPPSTEVRRF-PPDKKK 286 Q R RH PST RF PP+ K Sbjct: 146 QIPRFRHIGPSTPFPRFIPPNAYK 169 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 218 QSVRLRHAPPSTEVRRF-PPDKKK 286 Q R RH PST RF PP+ K Sbjct: 149 QIPRFRHIGPSTPFPRFIPPNAYK 172 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 4.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 203 LSDWRQSVRLRHAPPSTEVRRFPP 274 +S Q R RH PST RF P Sbjct: 383 ISMQEQIPRFRHIGPSTPFPRFIP 406 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 7.9 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +2 Query: 215 RQSVRLRHAPPSTEVRRFPPDKKKSIRLKSTVSVSTFK 328 +Q +L H P + P DKK + K V S+ K Sbjct: 1462 QQQQQLNHYPDLHNLYAVPTDKKSACDSKLIVDHSSQK 1499 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,877 Number of Sequences: 438 Number of extensions: 2693 Number of successful extensions: 31 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -