BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0406 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 25 0.85 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 25 0.85 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 25 0.85 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.0 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 6.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.0 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 21 8.0 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 24.6 bits (51), Expect = 0.85 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 364 SNGDQPPEFIPVRNG*SHSSNQQLELEPSMECSKYFWR 477 SNG P P R +++ +Q LELE ++Y R Sbjct: 223 SNGTFAPGMEPKRQRTAYTRHQILELEKEFHYNRYLTR 260 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 24.6 bits (51), Expect = 0.85 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 364 SNGDQPPEFIPVRNG*SHSSNQQLELEPSMECSKYFWR 477 SNG P P R +++ +Q LELE ++Y R Sbjct: 223 SNGTFAPGMEPKRQRTAYTRHQILELEKEFHYNRYLTR 260 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 24.6 bits (51), Expect = 0.85 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 364 SNGDQPPEFIPVRNG*SHSSNQQLELEPSMECSKYFWR 477 SNG P P R +++ +Q LELE ++Y R Sbjct: 223 SNGTFAPGMEPKRQRTAYTRHQILELEKEFHYNRYLTR 260 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.4 bits (48), Expect = 2.0 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 110 PADTIAAPSVEETQNKASFETIESGLKSLETNFN 211 P+DT + ++T+ A+ ETI GLK TN++ Sbjct: 1142 PSDTWFDENTKDTKITAASETILHGLKKY-TNYS 1174 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.8 bits (44), Expect = 6.0 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 4/69 (5%) Frame = +2 Query: 344 GPTNPLIQMVTNLQNSFLSGMANL-TQAINNWNSNQAWSVPNIFGG---ASTAAPQSDVQ 511 GP NPLI ++ NS+ + T W + S P+ G +T P V Sbjct: 381 GPKNPLINILYANMNSYSVPEPTISTTPRPEW--ARPPSTPSADGSKPVQTTPKPGQWVP 438 Query: 512 XDATTTTQR 538 +T+TTQR Sbjct: 439 EKSTSTTQR 447 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +2 Query: 464 NIFGGASTAAPQSDVQXDATTTTQRPAPWQNLP 562 N+ +TA P +TTT+ P N P Sbjct: 1335 NVVDIVTTAKPAQSTTSVSTTTSWNPGSTTNYP 1367 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 21.4 bits (43), Expect = 8.0 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +1 Query: 352 KSFNSNGDQPPEFIPVRNG*SHSSNQQLELEPSMECSKYFWR 477 K Q +P R ++++ Q LELE +KY R Sbjct: 121 KKTTRKSSQQENGLPRRLRTAYTNTQLLELEKEFHFNKYLCR 162 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,418 Number of Sequences: 336 Number of extensions: 3217 Number of successful extensions: 15 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -