BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0406 (750 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC039297-1|AAH39297.1| 1204|Homo sapiens fibronectin type III do... 30 7.7 AY358367-1|AAQ88733.1| 625|Homo sapiens YVTM2421 protein. 30 7.7 AB098597-1|BAC53727.1| 1204|Homo sapiens FAD104 protein. 30 7.7 >BC039297-1|AAH39297.1| 1204|Homo sapiens fibronectin type III domain containing 3B protein. Length = 1204 Score = 30.3 bits (65), Expect = 7.7 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = +1 Query: 313 HNSFYSNKHQWPYKSFNSNGDQPPEFIPVRNG*SHSSNQQLELEPSMECSKYFWR 477 H F N H Y GD PP+F P ++ H+ + E+ P S Y R Sbjct: 130 HPHFIHNSHTAYYPPVTGPGDMPPQFFP-QHHLPHTIYGEQEIIPFYGMSSYITR 183 >AY358367-1|AAQ88733.1| 625|Homo sapiens YVTM2421 protein. Length = 625 Score = 30.3 bits (65), Expect = 7.7 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = +1 Query: 313 HNSFYSNKHQWPYKSFNSNGDQPPEFIPVRNG*SHSSNQQLELEPSMECSKYFWR 477 H F N H Y GD PP+F P ++ H+ + E+ P S Y R Sbjct: 126 HPHFIHNSHTAYYPPVTGPGDMPPQFFP-QHHLPHTIYGEQEIIPFYGMSSYITR 179 >AB098597-1|BAC53727.1| 1204|Homo sapiens FAD104 protein. Length = 1204 Score = 30.3 bits (65), Expect = 7.7 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = +1 Query: 313 HNSFYSNKHQWPYKSFNSNGDQPPEFIPVRNG*SHSSNQQLELEPSMECSKYFWR 477 H F N H Y GD PP+F P ++ H+ + E+ P S Y R Sbjct: 130 HPHFIHNSHTAYYPPVTGPGDMPPQFFP-QHHLPHTIYGEQEIIPFYGMSSYITR 183 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,928,430 Number of Sequences: 237096 Number of extensions: 2078491 Number of successful extensions: 4358 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4358 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9015132854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -