BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0406 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 26 0.43 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 25 0.57 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 25 0.76 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 25 0.76 AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced prot... 24 1.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 24 1.3 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 4.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 4.0 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 5.3 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 7.1 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 7.1 AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding prote... 21 9.3 AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding prote... 21 9.3 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 21 9.3 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 9.3 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 21 9.3 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 25.8 bits (54), Expect = 0.43 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +3 Query: 393 SCPEWLISLKQSTTGTRTKHGVFQIFLAELALQPLSQMFXATQPPQ 530 + PE L+ LK T H + + ALQ +++ T+PP+ Sbjct: 271 NAPEGLLGLKLINAENETAHIKDSLIVLTSALQEMNKSKSITEPPK 316 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 25.4 bits (53), Expect = 0.57 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 487 CSPSVRCSXRRNHHNAETCAVAKSAV 564 CSPSV C R + + E A A S V Sbjct: 16 CSPSVHCGTRPSFVSDEMIATAASVV 41 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 25.0 bits (52), Expect = 0.76 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 307 SKHNSFYSNKHQWPYKSFNSNGDQPPEFIPVRNG 408 + +N+ Y+N ++ YK++ N +Q P +PV G Sbjct: 103 NNYNNNYNNNYKKLYKNYIINIEQIPVPVPVYYG 136 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 25.0 bits (52), Expect = 0.76 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 307 SKHNSFYSNKHQWPYKSFNSNGDQPPEFIPVRNG 408 + +N+ Y+N ++ YK++ N +Q P +PV G Sbjct: 103 NNYNNNYNNNYKKLYKNYIINIEQIPVPVPVYYG 136 >AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced protein 75 protein. Length = 87 Score = 24.2 bits (50), Expect = 1.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 268 RRGCS*KFQYRPCSKH 315 RR K QYRPC+K+ Sbjct: 43 RRSIQQKIQYRPCTKN 58 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.2 bits (50), Expect = 1.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 268 RRGCS*KFQYRPCSKH 315 RR K QYRPC+K+ Sbjct: 92 RRSIQQKIQYRPCTKN 107 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +2 Query: 47 HFQENFGAQIQKLNETLHFIKPADTIAAPSVEETQNKAS 163 H + G LN++LHF++ + + SV E ++++ Sbjct: 20 HILDTCGRDTYALNQSLHFVRASLSNLDMSVLECADRSA 58 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +2 Query: 47 HFQENFGAQIQKLNETLHFIKPADTIAAPSVEETQNKAS 163 H + G LN++LHF++ + + SV E ++++ Sbjct: 110 HILDTCGRDTYALNQSLHFVRASLSNLDMSVLECADRSA 148 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 213 AVLISYLKVFKLWLRSKPTERL 278 AV + L + LWL S+ TER+ Sbjct: 263 AVTMMLLTLTVLWLDSRSTERM 284 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/25 (24%), Positives = 15/25 (60%) Frame = +3 Query: 204 ISIAVLISYLKVFKLWLRSKPTERL 278 +++ +++ + + LWL TER+ Sbjct: 251 VTLTIVLMTMTLMTLWLEPSSTERM 275 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/34 (26%), Positives = 14/34 (41%) Frame = +1 Query: 277 CS*KFQYRPCSKHNSFYSNKHQWPYKSFNSNGDQ 378 C K Y + + K+QW Y +N D+ Sbjct: 16 CQAKAHYSLRDFKANIFQVKYQWKYFDYNFGSDE 49 >AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = -3 Query: 328 CRSCCALSRGGTGTFSCSLSVGFERS 251 C CAL T CS GF+ S Sbjct: 10 CVIYCALVHADTVAILCSQKAGFDLS 35 >AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = -3 Query: 328 CRSCCALSRGGTGTFSCSLSVGFERS 251 C CAL T CS GF+ S Sbjct: 10 CVIYCALVHADTVAILCSQKAGFDLS 35 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 21.4 bits (43), Expect = 9.3 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = +1 Query: 343 WPYKSFNSNGDQPPEF 390 WP+K + NG+ F Sbjct: 151 WPFKEYQMNGNNITNF 166 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 579 KLLICDGRFCHGAGL 535 K + C +FCH AG+ Sbjct: 162 KSITCALQFCHNAGI 176 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 21.4 bits (43), Expect = 9.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 746 SLQRVSQ*TEXQAYLVVRGLGS*MENFVHQKR 651 S+QR S TE + L S MEN + + R Sbjct: 163 SIQRKSDITELDVSKRCKDLASFMENLLQETR 194 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,905 Number of Sequences: 438 Number of extensions: 3785 Number of successful extensions: 20 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -