BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0403 (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 79 1e-16 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 23 6.6 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 6.6 AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 23 8.8 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 79.0 bits (186), Expect = 1e-16 Identities = 43/130 (33%), Positives = 74/130 (56%), Gaps = 2/130 (1%) Frame = +3 Query: 69 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 248 MA+ L + +I + + FS++D +G G + +LG +R+L NPT EL + G Sbjct: 1 MANDLKDVEIEKAQFVFSVYDWEGSGQMDAMDLGNALRALNLNPT-IELIGKMGGTQKRG 59 Query: 249 NGTIDFPEFLTMMA--RKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLT 422 I F EFL + + +K K+ E+ E +++DK+ +G + AEL H +T LGE+L Sbjct: 60 EKKIKFEEFLPIFSQVKKEKEQGCFEDFLECLKLYDKNEDGTMLLAELTHSLTALGERLD 119 Query: 423 DEEVDEMIRE 452 D E+D ++++ Sbjct: 120 DVELDNVMKD 129 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 23.0 bits (47), Expect = 6.6 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 287 HHCQELGKVYRAVSVRVYFIDHVLKFG 207 HH + G +Y V+ V F +L FG Sbjct: 253 HHSKVYGTMYAKVTECVLFHKDILSFG 279 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.0 bits (47), Expect = 6.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 94 RSPSLRRHSHCSTKTAMAPSRPKS 165 RSP RR S + T+ SRP S Sbjct: 272 RSPPARRRSRSTRPTSWPRSRPTS 295 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 22.6 bits (46), Expect = 8.8 Identities = 13/38 (34%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +2 Query: 197 PHRSRTSRHDQ*SRR---GRKRHDRLSRVLDNDGAQDE 301 P RH S R G H R R+ D+DG E Sbjct: 112 PEEKLRGRHSSESDREGMGHDSHKRTHRLSDSDGGSTE 149 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 462,186 Number of Sequences: 2352 Number of extensions: 7471 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -