BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0384 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 29 0.20 DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 24 5.8 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 28.7 bits (61), Expect = 0.20 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 384 RSSRTDCRRPHQRRPLREEYHSCR 313 +SS+TD R P Q P +++ SCR Sbjct: 314 KSSKTDHRHPFQYHPTYDQHKSCR 337 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 23.8 bits (49), Expect = 5.8 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +3 Query: 72 NGSIAEAV-NLSKQRNTIFVVFIQGDNDLSDEMSSTLNDVVVRSKLSNESN 221 N S+ +A ++ +Q + V I+ ++ DE ++L+ VVV ++ ESN Sbjct: 58 NNSVLQAYKDVLEQNYAVEVRDIERNDYNFDEPKTSLDPVVVEEEIIEESN 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 674,215 Number of Sequences: 2352 Number of extensions: 12780 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -