BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0383 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 22 4.9 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 4.9 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 8.5 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 22.2 bits (45), Expect = 4.9 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 120 IWIKENRRKRGKGEGKVARASFVGRQGAPRAG 25 IW+ + R R KG+G G G PR G Sbjct: 131 IWVPQKYRLRHKGDGS------PGGNGGPRNG 156 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 22.2 bits (45), Expect = 4.9 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 120 IWIKENRRKRGKGEGKVARASFVGRQGAPRAG 25 IW+ + R R KG+G G G PR G Sbjct: 131 IWVPQKYRLRHKGDGS------PGGNGGPRNG 156 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 194 LSSQPHPTLLPRIVGYD*QNVLRS 265 L P +LLP VGY +++ +S Sbjct: 393 LEDAPQNSLLPNFVGYKGKHIGKS 416 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,842 Number of Sequences: 438 Number of extensions: 2954 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -