BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0382 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 285 3e-77 SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) 147 7e-36 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 138 6e-33 SB_33442| Best HMM Match : AAA (HMM E-Value=0) 134 1e-31 SB_3774| Best HMM Match : DivIC (HMM E-Value=4.4) 116 2e-26 SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) 111 6e-25 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 2e-20 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 3e-19 SB_45627| Best HMM Match : AAA (HMM E-Value=0) 90 2e-18 SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_19460| Best HMM Match : AAA (HMM E-Value=0) 83 3e-16 SB_48561| Best HMM Match : AAA (HMM E-Value=0) 81 7e-16 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 76 4e-14 SB_7424| Best HMM Match : AAA (HMM E-Value=0) 73 3e-13 SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_55690| Best HMM Match : AAA (HMM E-Value=0) 67 2e-11 SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 65 5e-11 SB_3115| Best HMM Match : AAA (HMM E-Value=0) 65 5e-11 SB_28977| Best HMM Match : AAA (HMM E-Value=0) 38 6e-08 SB_732| Best HMM Match : AAA (HMM E-Value=0) 55 7e-08 SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) 42 5e-04 SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_10418| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_8559| Best HMM Match : Dpy-30 (HMM E-Value=3.7e-11) 35 0.081 SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) 34 0.11 SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) 33 0.33 SB_34154| Best HMM Match : UvrD-helicase (HMM E-Value=0.064) 33 0.33 SB_30757| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_59437| Best HMM Match : AAA (HMM E-Value=7.4e-08) 32 0.57 SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) 31 0.76 SB_21493| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_32676| Best HMM Match : adh_short (HMM E-Value=1.2e-05) 31 0.76 SB_13785| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_23422| Best HMM Match : Propeptide_C1 (HMM E-Value=7.2) 31 1.00 SB_53383| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.00 SB_47951| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_26897| Best HMM Match : AAA (HMM E-Value=4.2e-12) 30 1.7 SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 30 2.3 SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 30 2.3 SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) 29 3.0 SB_20265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 29 5.3 SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_12803| Best HMM Match : Lig_chan (HMM E-Value=0) 29 5.3 SB_12109| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_11032| Best HMM Match : AAA (HMM E-Value=3.5) 29 5.3 SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 28 7.0 SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_55825| Best HMM Match : Arch_fla_DE (HMM E-Value=2.9) 28 7.0 SB_25750| Best HMM Match : AFG1_ATPase (HMM E-Value=5.6e-12) 28 7.0 SB_3946| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_9874| Best HMM Match : Sigma54_activat (HMM E-Value=0) 28 9.3 SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) 28 9.3 SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 285 bits (699), Expect = 3e-77 Identities = 148/195 (75%), Positives = 158/195 (81%) Frame = +2 Query: 77 LQLIVAEKSQNLRRLQAQRNELNAKVRMLRXXXXXXXXXGSYVGEVVKPMDKKKVLVKVH 256 ++L+V EK +NLRRL+AQRNELNAKVRMLR GSYVGEVVKPMDKKKVLVKVH Sbjct: 82 VKLVVTEKIKNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVH 141 Query: 257 PEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEM 436 PEGKFVVD+DK +D+ +V DPLVSLMMVEKVPDSTYEM Sbjct: 142 PEGKFVVDIDKGIDMAEV-----------------------DPLVSLMMVEKVPDSTYEM 178 Query: 437 VGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECT 616 VGGLDKQIKEIKEVIELPVKHPELF+ALGI QPKGVLLYGPPGTGKTLLARAVAHHTECT Sbjct: 179 VGGLDKQIKEIKEVIELPVKHPELFEALGIDQPKGVLLYGPPGTGKTLLARAVAHHTECT 238 Query: 617 FIRVSGSELVQKFIG 661 FIRVSGSELVQKFIG Sbjct: 239 FIRVSGSELVQKFIG 253 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +1 Query: 691 FVMAREHAPSIIFMDEINSI 750 FV +REHAPSIIFMDEI+SI Sbjct: 277 FVDSREHAPSIIFMDEIDSI 296 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +3 Query: 648 KNLLGEGSRMVRELF---RNGQRTCSFYHFHGR 737 + +GEG+RMVRELF R+G+ + Y R Sbjct: 249 QKFIGEGARMVRELFVMARHGENLQAMYFVDSR 281 >SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 147 bits (357), Expect = 7e-36 Identities = 81/203 (39%), Positives = 121/203 (59%), Gaps = 3/203 (1%) Frame = +2 Query: 59 ITKIEELQLIVAEKSQNLRRLQAQRN---ELNAKVRMLRXXXXXXXXXGSYVGEVVKPMD 229 + +I++ L+ E QN RL+ Q E +KV LR VG + + +D Sbjct: 260 LDRIKDFLLMEEEFIQNQERLKPQEEKHEEERSKVDDLRGTPMS-------VGNLEEIID 312 Query: 230 KKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVE 409 +V + V + VD + + C V L ++ + + +L + DP+V++M +E Sbjct: 313 DNHAIVSTSVGSEHYVSILSFVDKDLLEPGCTVLLNHKVHAVVGVLSDDADPMVTVMKLE 372 Query: 410 KVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLAR 589 K P +Y +GGLD QI+EIKE +ELP+ HPEL++ +GI PKGV+LYG PGTGKTLLA+ Sbjct: 373 KAPQESYADIGGLDTQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGQPGTGKTLLAK 432 Query: 590 AVAHHTECTFIRVSGSELVQKFI 658 AVA+ T TF+RV GSEL+QK++ Sbjct: 433 AVANQTSATFLRVVGSELIQKYL 455 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 138 bits (333), Expect = 6e-33 Identities = 65/109 (59%), Positives = 83/109 (76%) Frame = +2 Query: 335 RNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFD 514 RN+ Y +H LP K+DP V++M VE+ PD TY +GG +QI +++EV+E P+ HPE F Sbjct: 53 RNK-YQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIDKLREVVETPLLHPERFV 111 Query: 515 ALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIG 661 LGI PKGVLL+GPPGTGKTL ARAVA+ T+ FIRV GSELVQK++G Sbjct: 112 NLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVG 160 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 134 bits (323), Expect = 1e-31 Identities = 64/153 (41%), Positives = 97/153 (63%) Frame = +2 Query: 203 VGEVVKPMDKKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVD 382 +G+ ++ +D+ +V + V + +D + + VAL S L ILP + D Sbjct: 88 IGQFLEAVDQNTGIVASTTGSNYYVRILSTIDKELLKPSASVALHKHSNALVDILPPEAD 147 Query: 383 PLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPP 562 ++++ E+ P+ +Y +GG+D Q +EI+E +ELP+ H EL+ +GI P+GVLLYGPP Sbjct: 148 SSIAMLTNEEKPNVSYAEIGGMDIQKQEIREAVELPLTHFELYKQIGIDPPRGVLLYGPP 207 Query: 563 GTGKTLLARAVAHHTECTFIRVSGSELVQKFIG 661 G GKT+LA+AVAHHT FIRV GSE VQK++G Sbjct: 208 GCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLG 240 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/20 (60%), Positives = 19/20 (95%) Frame = +1 Query: 691 FVMAREHAPSIIFMDEINSI 750 F +A+E+AP+IIF+DEI++I Sbjct: 250 FRLAKENAPAIIFIDEIDAI 269 >SB_3774| Best HMM Match : DivIC (HMM E-Value=4.4) Length = 158 Score = 116 bits (279), Expect = 2e-26 Identities = 55/75 (73%), Positives = 63/75 (84%) Frame = +2 Query: 77 LQLIVAEKSQNLRRLQAQRNELNAKVRMLRXXXXXXXXXGSYVGEVVKPMDKKKVLVKVH 256 ++L+V EK +NLRRL+AQRNELNAKVRMLR GSYVGEVVKPMDKKKVLVKVH Sbjct: 82 VKLVVTEKIKNLRRLEAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVH 141 Query: 257 PEGKFVVDLDKNVDI 301 PEGKFVVD+DK +D+ Sbjct: 142 PEGKFVVDIDKGIDM 156 >SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) Length = 779 Score = 111 bits (267), Expect = 6e-25 Identities = 57/124 (45%), Positives = 80/124 (64%) Frame = +2 Query: 194 GSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPN 373 G VGEV+K + ++K +VK ++VV + VD + RVAL + T+ + LP Sbjct: 56 GQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQVDKAKLKQGTRVALDMTTLTIMRYLPR 115 Query: 374 KVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLY 553 +VDPLV M E + +Y VGGL +QI+E++EVIELP+ +PELF +GIA PKG LL+ Sbjct: 116 EVDPLVYNMSHEDPGNISYSDVGGLSEQIRELREVIELPLTNPELFQRVGIAPPKGCLLF 175 Query: 554 GPPG 565 GPPG Sbjct: 176 GPPG 179 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 96.7 bits (230), Expect = 2e-20 Identities = 46/89 (51%), Positives = 64/89 (71%) Frame = +2 Query: 410 KVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLAR 589 K+PD +++ VGGLD +EI + I+LP+ HPELF A G+ + GVLLYGPPGTGKTL+A+ Sbjct: 805 KIPDISWKDVGGLDSVKEEILDTIQLPLLHPELF-AAGLRR-SGVLLYGPPGTGKTLMAK 862 Query: 590 AVAHHTECTFIRVSGSELVQKFIGRRQQN 676 AVA F+ V G EL+ ++G+ +QN Sbjct: 863 AVATECSLNFLSVKGPELINMYVGQSEQN 891 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 92.7 bits (220), Expect = 3e-19 Identities = 37/82 (45%), Positives = 61/82 (74%) Frame = +2 Query: 425 TYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHH 604 +++ +GGL QI+ ++E+IE+P+ +PELF A G+ P+G+LLYGP GTGKT++ARAVA+ Sbjct: 254 SFQSIGGLKTQIQAVREMIEMPLTNPELFTAYGVPPPRGILLYGPSGTGKTMIARAVANE 313 Query: 605 TECTFIRVSGSELVQKFIGRRQ 670 T F ++G E++ ++ G + Sbjct: 314 TGVHFFCINGPEVLSRYYGETE 335 Score = 89.4 bits (212), Expect = 3e-18 Identities = 39/88 (44%), Positives = 58/88 (65%) Frame = +2 Query: 410 KVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLAR 589 +VP + VGG + +++KE +E P+KHPE F LGI P+G+L+YGPPG KTL+AR Sbjct: 530 EVPKVHWSDVGGNEMIKRKLKEAVEWPLKHPEAFQRLGIRPPRGILMYGPPGCSKTLIAR 589 Query: 590 AVAHHTECTFIRVSGSELVQKFIGRRQQ 673 A+A + FI + G EL K++G ++ Sbjct: 590 ALATESGLNFIAIKGPELFSKWVGESEK 617 Score = 27.9 bits (59), Expect = 9.3 Identities = 18/64 (28%), Positives = 33/64 (51%) Frame = +1 Query: 559 SGHWKDIISSCCRSPH*VYFHTCFWIRIGTKIYWEKAAEWCESSFVMAREHAPSIIFMDE 738 SG K +I+ + V+F + ++ Y E A E F A+ +PSI+F+DE Sbjct: 299 SGTGKTMIARAVANETGVHFFCINGPEVLSRYYGETEARLREI-FTEAQNKSPSIVFIDE 357 Query: 739 INSI 750 ++++ Sbjct: 358 LDAL 361 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 691 FVMAREHAPSIIFMDEINSI 750 F+ AR APSI+F DE+++I Sbjct: 623 FLKARATAPSIVFFDELDAI 642 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 90.2 bits (214), Expect = 2e-18 Identities = 38/91 (41%), Positives = 62/91 (68%) Frame = +2 Query: 404 VEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLL 583 V +VP+ +++ +GGL+ +E++E+++ PV+HP+ F G+ KGVL YGPPG GKTLL Sbjct: 301 VVEVPNVSWDDIGGLEGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLL 360 Query: 584 ARAVAHHTECTFIRVSGSELVQKFIGRRQQN 676 A+A+A+ + FI + G EL+ + G + N Sbjct: 361 AKAIANECQANFISIKGPELLTMWFGESEAN 391 >SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/86 (41%), Positives = 57/86 (66%) Frame = +2 Query: 404 VEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLL 583 V ++ + ++ VGGL+ + +++ IE P+ HPE F +G+ +P+GVLLYGPPG KT L Sbjct: 475 VVRLQPTRWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPRGVLLYGPPGCCKTTL 534 Query: 584 ARAVAHHTECTFIRVSGSELVQKFIG 661 RA A T CTF+ +S ++L ++G Sbjct: 535 VRAAASSTHCTFMSLSCAQLFSSYVG 560 Score = 70.5 bits (165), Expect = 1e-12 Identities = 41/132 (31%), Positives = 66/132 (50%) Frame = +2 Query: 299 INDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEV 478 I DVT+ + N +Y ++ K + + + V DS ++ GLD IK +KE+ Sbjct: 174 IEDVTS----VIDNNAYV---VITEKTNINIESVKVGSSVDSGNIILSGLDDSIKMLKEL 226 Query: 479 IELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFI 658 ++ P+ +PE F LGI PKG+LL G PG GKTLL + +G+++ Sbjct: 227 VQFPLYYPESFSHLGINGPKGILLVGAPGVGKTLLVHKATVDCGIKLVSTNGTDVFGPHA 286 Query: 659 GRRQQNGARALS 694 G ++N R + Sbjct: 287 GESEENLRRVFN 298 >SB_19460| Best HMM Match : AAA (HMM E-Value=0) Length = 340 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/86 (41%), Positives = 57/86 (66%) Frame = +2 Query: 404 VEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLL 583 V ++ + ++ VGGL+ + +++ IE P+ HPE F +G+ +P+GVLLYGPPG KT L Sbjct: 4 VVRLQPTRWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPRGVLLYGPPGCCKTTL 63 Query: 584 ARAVAHHTECTFIRVSGSELVQKFIG 661 RA A T CTF+ +S ++L ++G Sbjct: 64 VRAAASSTHCTFMSLSCAQLFSSYVG 89 >SB_48561| Best HMM Match : AAA (HMM E-Value=0) Length = 2021 Score = 81.4 bits (192), Expect = 7e-16 Identities = 37/87 (42%), Positives = 60/87 (68%), Gaps = 5/87 (5%) Frame = +2 Query: 428 YEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHH- 604 ++ VGGL+KQI+ +KE+I P+ +PE+FD I P+GVL +GPPGTGKTL+ARA+A+ Sbjct: 883 FDSVGGLNKQIQALKEMILFPLVYPEVFDKFKITPPRGVLFFGPPGTGKTLVARALANEC 942 Query: 605 ----TECTFIRVSGSELVQKFIGRRQQ 673 + +F G++ + K++G ++ Sbjct: 943 SQGDKKVSFFMRKGADCLSKWVGESER 969 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 75.8 bits (178), Expect = 4e-14 Identities = 32/62 (51%), Positives = 44/62 (70%) Frame = +2 Query: 488 PVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGRR 667 PV+HPE F ALG+ P G+LL GPPG GKTLLA+A+A+ + FI V G EL+ ++G Sbjct: 2 PVQHPEEFSALGLTHPPGILLAGPPGCGKTLLAKAIANESGINFISVKGPELLNMYVGES 61 Query: 668 QQ 673 ++ Sbjct: 62 ER 63 >SB_7424| Best HMM Match : AAA (HMM E-Value=0) Length = 294 Score = 72.5 bits (170), Expect = 3e-13 Identities = 37/86 (43%), Positives = 53/86 (61%) Frame = +2 Query: 404 VEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLL 583 V V +S + V G ++ EI E + +K+P+ + LG PKG +L GPPGTGKTLL Sbjct: 39 VTYVKESEWIDVAGCEEAKLEIMEFVNF-LKNPQQYHELGAKIPKGAILSGPPGTGKTLL 97 Query: 584 ARAVAHHTECTFIRVSGSELVQKFIG 661 A+AVA F+ +SGSE ++ F+G Sbjct: 98 AKAVAGEAGVPFLSISGSEFLEMFVG 123 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +1 Query: 691 FVMAREHAPSIIFMDEINSI 750 F AR++AP IIF+DEI+++ Sbjct: 133 FAQARKNAPCIIFIDEIDAV 152 >SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = +2 Query: 488 PVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELV 646 PV+HPE F ALG+ P G+LL GPPG GKTLLA+A+A+ + FI V G EL+ Sbjct: 2 PVQHPEEFSALGLTHPPGILLAGPPGCGKTLLAKAIANESGINFISVKGPELL 54 >SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 70.5 bits (165), Expect = 1e-12 Identities = 41/132 (31%), Positives = 66/132 (50%) Frame = +2 Query: 299 INDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEV 478 I DVT+ + N +Y ++ K + + + V DS ++ GLD IK +KE+ Sbjct: 4 IEDVTS----VIDNNAYV---VITEKTNINIESVKVGSSVDSGNIILSGLDDSIKMLKEL 56 Query: 479 IELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFI 658 ++ P+ +PE F LGI PKG+LL G PG GKTLL + +G+++ Sbjct: 57 VQFPLYYPESFSHLGINGPKGILLVGAPGVGKTLLVHKATVDCGIKLVSTNGTDVFGPHA 116 Query: 659 GRRQQNGARALS 694 G ++N R + Sbjct: 117 GESEENLRRVFN 128 >SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 67.3 bits (157), Expect = 1e-11 Identities = 36/92 (39%), Positives = 56/92 (60%), Gaps = 1/92 (1%) Frame = +2 Query: 401 MVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQP-KGVLLYGPPGTGKT 577 +++K P+ + + L + K ++E + LP+ P+ F GI +P +GVL+ GPPGTGKT Sbjct: 240 ILQKNPNVHWADIADLHEAKKLLEEAVVLPLLMPDYFQ--GIRRPWRGVLMVGPPGTGKT 297 Query: 578 LLARAVAHHTECTFIRVSGSELVQKFIGRRQQ 673 +LA+AVA TF VS S L K+ G ++ Sbjct: 298 MLAKAVATECGTTFFNVSSSTLTSKYRGESEK 329 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +1 Query: 691 FVMAREHAPSIIFMDEINSI 750 F MAR +APS IF+DEI+SI Sbjct: 335 FEMARFYAPSTIFVDEIDSI 354 >SB_55690| Best HMM Match : AAA (HMM E-Value=0) Length = 1031 Score = 66.9 bits (156), Expect = 2e-11 Identities = 36/82 (43%), Positives = 46/82 (56%) Frame = +2 Query: 428 YEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHT 607 +E VGGL ++E + P K LF + G+LLYGPPGTGKTLLA VA Sbjct: 666 WENVGGLGPVKGVLQETLLWPSKFAGLFAKCPLRLRGGLLLYGPPGTGKTLLAGVVAKEC 725 Query: 608 ECTFIRVSGSELVQKFIGRRQQ 673 FI + G EL+ K+IG +Q Sbjct: 726 GLNFISIKGPELLSKYIGASEQ 747 >SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 66.9 bits (156), Expect = 2e-11 Identities = 35/72 (48%), Positives = 47/72 (65%) Frame = +2 Query: 446 LDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIR 625 +D+ +E++EV+E +++PE F LG P GVLL G PGTGKTLLA+AVA F Sbjct: 136 VDEAKEELQEVVEF-LRNPEKFKRLGGKLPTGVLLIGSPGTGKTLLAKAVAGEAGVPFFF 194 Query: 626 VSGSELVQKFIG 661 SGSE + F+G Sbjct: 195 CSGSEFDEMFVG 206 Score = 31.1 bits (67), Expect = 1.00 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +1 Query: 691 FVMAREHAPSIIFMDEINSI 750 F A+EHAP I+F+DE+++I Sbjct: 216 FAAAKEHAPCIVFVDELDAI 235 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 65.3 bits (152), Expect = 5e-11 Identities = 28/79 (35%), Positives = 50/79 (63%) Frame = +2 Query: 437 VGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECT 616 +GG ++++ +++ + + HPE+F LG+ G LL+GPPG GKTLLA A+A E Sbjct: 679 IGGCSNTLEQVGKLL-VHMCHPEVFTTLGVTPTTGFLLHGPPGCGKTLLAHAIAGELEMP 737 Query: 617 FIRVSGSELVQKFIGRRQQ 673 F++++ +E+V G ++ Sbjct: 738 FLKLAATEIVSGVSGESEE 756 >SB_3115| Best HMM Match : AAA (HMM E-Value=0) Length = 913 Score = 65.3 bits (152), Expect = 5e-11 Identities = 32/78 (41%), Positives = 48/78 (61%) Frame = +2 Query: 428 YEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHT 607 ++ V G+ + E+ E ++ +K + LG PKG LL GPPGTGKTLLA+AVA Sbjct: 124 FKDVAGMQEAKMEVMEFVDY-LKSAGRYTQLGAKIPKGALLVGPPGTGKTLLAKAVATEA 182 Query: 608 ECTFIRVSGSELVQKFIG 661 + F+ ++GS+ V+ F G Sbjct: 183 DVPFLSMAGSDFVEMFAG 200 >SB_28977| Best HMM Match : AAA (HMM E-Value=0) Length = 442 Score = 37.5 bits (83), Expect(2) = 6e-08 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +2 Query: 386 LVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQP-KGVLLYG 556 L S +++EK P+ + + GL+ + +KE + LP+K P LF G P +G+LLYG Sbjct: 83 LNSAIVMEK-PNVKWSDIAGLESAKEALKEAVILPIKFPHLF--TGKRTPWRGILLYG 137 Score = 37.1 bits (82), Expect(2) = 6e-08 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +2 Query: 563 GTGKTLLARAVA-HHTECTFIRVSGSELVQKFIGRRQQ 673 GTGK+ LA+AVA TFI VS S+LV K++G ++ Sbjct: 175 GTGKSYLAKAVATEANNSTFISVSSSDLVSKWLGESER 212 Score = 31.1 bits (67), Expect = 1.00 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +1 Query: 691 FVMAREHAPSIIFMDEINSI 750 F +ARE+ PSIIF+DE++S+ Sbjct: 218 FELARENKPSIIFIDEVDSL 237 >SB_732| Best HMM Match : AAA (HMM E-Value=0) Length = 388 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/59 (40%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = +2 Query: 503 ELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIR-VSGSELVQKFIGRRQQN 676 ++ D +G+ KG+LL+GPPGTGKTL+AR + + +SG E++ KF+G + N Sbjct: 172 DVVDKMGLKHVKGILLFGPPGTGKTLMARQIGTMLNTREPKIISGPEVLNKFVGESEAN 230 >SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) Length = 430 Score = 41.9 bits (94), Expect = 5e-04 Identities = 15/37 (40%), Positives = 27/37 (72%) Frame = +2 Query: 536 KGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELV 646 + +L YGPPGTGKT+ A+++A H+ + ++G ++V Sbjct: 330 RNLLFYGPPGTGKTMFAKSLARHSGMDYAVMTGGDVV 366 >SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/79 (27%), Positives = 41/79 (51%) Frame = +2 Query: 233 KKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEK 412 K ++K + + + V+ ++T V + +SY + + LP + D V M V++ Sbjct: 88 KCAVIKTSTRQTYFLPVIGLVEPENLTPGDLVGVNKDSYLILEKLPAEYDSRVKAMEVDE 147 Query: 413 VPDSTYEMVGGLDKQIKEI 469 P Y +GGLD+QI+E+ Sbjct: 148 RPTEQYSDIGGLDQQIQEM 166 Score = 31.1 bits (67), Expect = 1.00 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = +1 Query: 670 AEWCESSFVMAREHAPSIIFMDEINSI 750 A+ +F +A+E AP+IIF+DE+++I Sbjct: 172 AKLVRDAFALAKEKAPAIIFIDELDAI 198 >SB_10418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +2 Query: 512 DALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSE 640 D G K LL GPPG GKT LA +A H + ++ S+ Sbjct: 373 DDNGYPVHKVALLCGPPGLGKTTLAHVIAQHAGYNVVEMNASD 415 >SB_8559| Best HMM Match : Dpy-30 (HMM E-Value=3.7e-11) Length = 806 Score = 34.7 bits (76), Expect = 0.081 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +2 Query: 533 PKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGRRQQNGARA 688 P + GPP +GKTL+ + + H + IR+ ++ + I + QQ+ ARA Sbjct: 358 PVRACILGPPASGKTLVVKQLCTHYKLHHIRI--QSVIDEAIEKLQQSAARA 407 >SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) Length = 420 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +2 Query: 446 LDKQIKE--IKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVA 598 LD+ I E + +V E + P + GI +G LLYGPPG GK+ +A+A Sbjct: 192 LDEGIAEGILADVKEF-IGSPRWYMDRGIPYRRGYLLYGPPGCGKSSFIQALA 243 >SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 2065 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +2 Query: 533 PKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSE 640 P+ +LL G PG GKT L A+A + +R++ SE Sbjct: 1617 PRPILLEGSPGVGKTSLVSAIAKASGHELVRINLSE 1652 Score = 31.1 bits (67), Expect = 1.00 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +2 Query: 518 LGIAQPKGVLLYGPPGTGKTLLARAVA 598 L +A GVLL GP G+GKT L VA Sbjct: 113 LAVAAGSGVLLEGPVGSGKTCLVEHVA 139 >SB_34154| Best HMM Match : UvrD-helicase (HMM E-Value=0.064) Length = 1064 Score = 32.7 bits (71), Expect = 0.33 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +2 Query: 521 GIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGR 664 G ++P L++GPPGTGKT+ V + SG+++ +K GR Sbjct: 547 GTSRPHPYLIFGPPGTGKTI--TVVESIKQVMINHESGNKVTRKDEGR 592 >SB_30757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 32.3 bits (70), Expect = 0.43 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 Query: 307 CHGQLSCRSSQRKLYLTQNTTQQSRSSCV 393 CH LSC SQR L Q Q+SR CV Sbjct: 114 CHVGLSCLKSQRTLRALQKALQRSRVECV 142 >SB_59437| Best HMM Match : AAA (HMM E-Value=7.4e-08) Length = 568 Score = 31.9 bits (69), Expect = 0.57 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 527 AQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQK 652 A K LL GPPG GKT A V +++ ++ S+ K Sbjct: 269 ASLKAALLSGPPGVGKTTTATLVCQELGYSYVEMNASDARSK 310 >SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) Length = 609 Score = 31.5 bits (68), Expect = 0.76 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +2 Query: 542 VLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQ 649 +LL GP G+GKTLLA+ +A + F + L Q Sbjct: 273 ILLLGPTGSGKTLLAQTIARCLDVPFAICDCTALTQ 308 >SB_21493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 31.5 bits (68), Expect = 0.76 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +2 Query: 536 KGVLLYGPPGTGKTLLARAVAHH--TECTFIRVSGSEL 643 + VL+ G PGTGKT +A +A + F ++GSE+ Sbjct: 170 RAVLIAGQPGTGKTAIAMGMAQSLGPDTPFTSIAGSEI 207 >SB_32676| Best HMM Match : adh_short (HMM E-Value=1.2e-05) Length = 201 Score = 31.5 bits (68), Expect = 0.76 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 3/65 (4%) Frame = +2 Query: 266 KFVVDLDKNV---DINDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEM 436 K ++D D V DIN+ T N + L +E+Y+ H++L K D + S +E T ++ Sbjct: 23 KALLDRDGKVCMLDINEKTGNETLKLLSENYSKHRVLFIKCD-VTSQPQMEAAFQRTKDV 81 Query: 437 VGGLD 451 G LD Sbjct: 82 FGRLD 86 >SB_13785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 31.5 bits (68), Expect = 0.76 Identities = 23/62 (37%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +2 Query: 440 GGLDKQIKEIKEVIE-LPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECT 616 GG D+ KEI V E +P D I V + G PG+GKT LA+ +A + T Sbjct: 311 GGPDEAFKEISRVFEGVPDSSNAALDDFDI-----VFIVGGPGSGKTELAKLLAESSGRT 365 Query: 617 FI 622 I Sbjct: 366 HI 367 >SB_23422| Best HMM Match : Propeptide_C1 (HMM E-Value=7.2) Length = 628 Score = 31.1 bits (67), Expect = 1.00 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 521 GIAQPKGVLLYGPPGTGKTL 580 G ++P LL+GPPGTGKT+ Sbjct: 587 GQSRPTPYLLFGPPGTGKTV 606 >SB_53383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.1 bits (67), Expect = 1.00 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +2 Query: 518 LGIAQPKGVLLYGPPGTGKTLLARAVA 598 L +A GVLL GP G+GKT L VA Sbjct: 113 LAVAAGSGVLLEGPVGSGKTCLVEHVA 139 >SB_47951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/24 (54%), Positives = 19/24 (79%), Gaps = 2/24 (8%) Frame = +2 Query: 512 DALGIA--QPKGVLLYGPPGTGKT 577 +A+G A QP+ +++GPPGTGKT Sbjct: 241 EAVGFALRQPEVAVIHGPPGTGKT 264 >SB_26897| Best HMM Match : AAA (HMM E-Value=4.2e-12) Length = 230 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +2 Query: 542 VLLYGPPGTGKTLLARAVA 598 +L YGPPGTGKT AVA Sbjct: 13 LLFYGPPGTGKTSTILAVA 31 >SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 541 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 296 DINDVTANCRVALRNESYTLHKILPNKVDPL 388 DI ++ C+VA E +TL + LPN +D L Sbjct: 154 DIRPISLTCQVAKLMEGFTLSRALPNILDRL 184 >SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 296 DINDVTANCRVALRNESYTLHKILPNKVDPL 388 DI ++ C+VA E +TL + LPN +D L Sbjct: 525 DIRPISLTCQVAKLMEGFTLSRALPNILDRL 555 >SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 476 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 296 DINDVTANCRVALRNESYTLHKILPNKVDPL 388 DI ++ C+VA E +TL + LPN +D L Sbjct: 89 DIRPISLTCQVAKLMEGFTLSRALPNILDRL 119 >SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) Length = 1065 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 284 DKNVDINDVTANCRVALRNESYTLHKILPNKVDPL 388 D N+ + + +CR A+ E+++ H PN VDPL Sbjct: 215 DCNLQLTCLQPSCRYAVLVEAFSSHPNDPNAVDPL 249 >SB_20265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/52 (21%), Positives = 27/52 (51%) Frame = +2 Query: 305 DVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQI 460 D+ + L + LHK++PN V+ + + ++ D ++ ++G D ++ Sbjct: 463 DLVKKAQTTLATANLRLHKVVPNSVEVMEAFPAEDRAKDISWGVLGPRDGRV 514 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +2 Query: 281 LDKNVDINDVTANCRVALRNESYTLHKILPNKVDPLVSLMMVEKVP 418 +D+N + + N +L L ++PN VD + M++KVP Sbjct: 952 IDENFKVWLIEINVNPSLSTSCQVLKDLMPNMVDNTIRPEMIQKVP 997 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +2 Query: 527 AQPKGVLLYGPPGTGKTLLARAV 595 A K VLL GPPG GKT L V Sbjct: 49 AYKKHVLLTGPPGIGKTTLCSKV 71 >SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1669 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +2 Query: 296 DINDVTANCRVALRNESYTLHKILP---NKVDP 385 DI + C+VA E +TL++ILP K+DP Sbjct: 1274 DIRPIALTCQVAKVMEGFTLNRILPPIMRKLDP 1306 >SB_12803| Best HMM Match : Lig_chan (HMM E-Value=0) Length = 1001 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -3 Query: 394 RHKRIDFVG*YFV*GIAFVAKSDTTIGRDIVNINVLV 284 R + IDF Y GI +A++DTT+G +VN++ ++ Sbjct: 390 RSRVIDFSSPYGEVGIGILARTDTTLG-SVVNMDFMI 425 >SB_12109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4085 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 542 VLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQK 652 ++L G GTGK + R A +C FI+ S + Q+ Sbjct: 2179 MMLVGVGGTGKVTVVRLAAFIQDCRFIKPQVSRVYQR 2215 >SB_11032| Best HMM Match : AAA (HMM E-Value=3.5) Length = 111 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +1 Query: 691 FVMAREHAPSIIFMDEINSI 750 F +AR + P++IFMDEI+S+ Sbjct: 12 FAVARCYLPAVIFMDEIDSL 31 >SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1786 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = +2 Query: 209 EVVKPMDKKKVLVKVHPEGKFVVDLDKNVDINDVTANCRVALRNESYTLHKILPNKVDPL 388 + V P+ K + VHP K D+ ++ C++A E +TL ++LP+ ++ L Sbjct: 309 DFVPPLLKSAI---VHPISKQTPPKSIKDDLRPISLTCQMAKICEGFTLIRVLPSVLEQL 365 >SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 808 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/51 (27%), Positives = 30/51 (58%) Frame = +2 Query: 353 LHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPE 505 L+K+L ++ S+ +E+ + + V GL+K+IK++++ EL K + Sbjct: 511 LNKVLERNMELESSVSAMERKNKALEKSVNGLEKEIKKMEQNYELKSKESD 561 >SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 1799 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 296 DINDVTANCRVALRNESYTLHKILPNKVDPL 388 DI ++ C+VA E TL + LPN +D L Sbjct: 473 DIRPISLTCQVAKLMEGLTLSRALPNILDRL 503 >SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3133 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/52 (38%), Positives = 26/52 (50%) Frame = +2 Query: 446 LDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAH 601 L K KE I VK +LF + + K VLL G PG GKT L + + + Sbjct: 959 LKKLFKE--PTISENVKINDLFKSKTKKRMKRVLLEGNPGVGKTTLCKKLVN 1008 >SB_55825| Best HMM Match : Arch_fla_DE (HMM E-Value=2.9) Length = 208 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/52 (38%), Positives = 26/52 (50%) Frame = +2 Query: 446 LDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAH 601 L K KE I VK +LF + + K VLL G PG GKT L + + + Sbjct: 146 LKKLFKE--PTISENVKINDLFKSKTKKRMKRVLLEGNPGVGKTTLCKKLVN 195 >SB_25750| Best HMM Match : AFG1_ATPase (HMM E-Value=5.6e-12) Length = 424 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 533 PKGVLLYGPPGTGKTLL 583 PKG+ LYG G+GKT+L Sbjct: 8 PKGLYLYGGVGSGKTIL 24 >SB_3946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 296 DINDVTANCRVALRNESYTLHKILPNKVDPL 388 DI ++ C+VA E TL + LPN +D L Sbjct: 511 DIRPISLTCQVAKLMEGLTLSRALPNILDRL 541 >SB_9874| Best HMM Match : Sigma54_activat (HMM E-Value=0) Length = 314 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +2 Query: 542 VLLYGPPGTGKTLLARAVAHHT---ECTFIRVSGSELVQKFI 658 VL+ G GTGK L+ARA+ +++ + FI+V+ + L + + Sbjct: 191 VLISGESGTGKELIARAIHYNSRRAKGPFIKVNCAALPESLL 232 >SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) Length = 2748 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 545 LLYGPPGTGKTLLARAVAHH 604 ++YG PGTGK+ A A+A H Sbjct: 2169 MVYGQPGTGKSWTAVAIACH 2188 >SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1837 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +2 Query: 296 DINDVTANCRVALRNESYTLHKILP---NKVDP 385 DI + C+VA E +TL +ILP K+DP Sbjct: 1491 DIRPIALTCQVAKVMEGFTLSRILPPIMRKLDP 1523 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,843,980 Number of Sequences: 59808 Number of extensions: 456024 Number of successful extensions: 1417 Number of sequences better than 10.0: 61 Number of HSP's better than 10.0 without gapping: 1248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1402 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -