BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0380 (722 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 25 0.47 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.8 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 22 5.8 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 22 5.8 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 7.6 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 25.4 bits (53), Expect = 0.47 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -2 Query: 337 SRLLLYHQHLSFCQRFGFELFVGRLDVLTPLTTVNCENIQKLSVSGMS 194 S +L + SF Q F F + G+ + PL V+ +N+Q++ + S Sbjct: 18 SDAVLAYPQPSFHQTFSFVVIFGQFFGIMPLHGVSRKNVQEIRLEWKS 65 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.8 Identities = 6/22 (27%), Positives = 15/22 (68%) Frame = -3 Query: 369 VIFLICMFILFHAFSCIINIFH 304 V FL+C + ++AF ++ +++ Sbjct: 94 VHFLLCTYYFYYAFIILLCVYY 115 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 358 NLHVYLVSRLLLYHQHLSF 302 N H++ S LL++ HL F Sbjct: 125 NRHIFRTSVLLIFVMHLMF 143 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 358 NLHVYLVSRLLLYHQHLSF 302 N H++ S LL++ HL F Sbjct: 125 NRHIFRTSVLLIFVMHLMF 143 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 628 HFSNXSSSITKNILKCAF 681 H+ N + KN+LKC + Sbjct: 365 HWLNKGAEQAKNVLKCVW 382 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,124 Number of Sequences: 336 Number of extensions: 3290 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -