BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0380 (722 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0078 + 20727684-20728036,20728871-20728895,20729218-207293... 30 2.1 08_02_0841 - 21749599-21749978,21750409-21753367 28 8.6 >09_06_0078 + 20727684-20728036,20728871-20728895,20729218-20729347, 20729441-20729571,20729654-20729742,20730127-20730203, 20730279-20730412 Length = 312 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = +1 Query: 7 CSIQGRLAQLIFAAPSAFSHQSRIDIQHSPGFISAPLSYAPVTSIFSGKAGSKETILSPV 186 CS G Q + AA A +DI+ SP I+A + Y +T + K K+ L+ Sbjct: 217 CSTLGMNNQAVKAAQEAVQRSEELDIRRSPISIAAAVIYM-ITQLSDDKKPLKDISLATG 275 Query: 187 ITE 195 + E Sbjct: 276 VAE 278 >08_02_0841 - 21749599-21749978,21750409-21753367 Length = 1112 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = -1 Query: 209 GVRYVSVITGESIVSLDPAFPENIDVTG 126 GV + ++T + +V DP+FP+N+D+ G Sbjct: 1004 GVILLELLTKKQVV--DPSFPDNMDIVG 1029 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,054,000 Number of Sequences: 37544 Number of extensions: 299792 Number of successful extensions: 621 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 621 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -