BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0380 (722 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 25 1.8 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 24 5.5 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 25.4 bits (53), Expect = 1.8 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -3 Query: 396 WRLFLVRELVIFLICMFILFHAFSCIINIFHSV 298 W++ L+R LV FLI ++ A+ I+ + S+ Sbjct: 326 WKIILLRILVNFLILGLLVISAYEVILVVKRSM 358 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 223 YFHNLPLSRALEHPVSLQKVQSRTFDRMKDVDDT 324 + H+LP S AL +L + Q +TF + V T Sbjct: 286 HHHHLPPSTALVQQTNLAEQQQKTFRDLNMVSAT 319 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,205 Number of Sequences: 2352 Number of extensions: 14402 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -