BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0380 (722 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC128190-1|AAI28191.1| 177|Homo sapiens transmembrane protein 1... 31 5.5 BC128189-1|AAI28190.1| 177|Homo sapiens transmembrane protein 1... 31 5.5 AF442729-1|AAL35294.1| 177|Homo sapiens MDAC1 protein. 31 5.5 >BC128190-1|AAI28191.1| 177|Homo sapiens transmembrane protein 190 protein. Length = 177 Score = 30.7 bits (66), Expect = 5.5 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +1 Query: 1 LVCSIQGRLAQLIFAAPSAFSHQSRIDIQHSPGFISAPLSYAPVTSIFSGKAGSKET 171 LV + G L L+ + F R D+ H PGF++ P + S+ S G+K+T Sbjct: 84 LVWTCSGLL--LLSCSICLFWWAKRRDVLHMPGFLAGPCDMSKSVSLLSKHRGTKKT 138 >BC128189-1|AAI28190.1| 177|Homo sapiens transmembrane protein 190 protein. Length = 177 Score = 30.7 bits (66), Expect = 5.5 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +1 Query: 1 LVCSIQGRLAQLIFAAPSAFSHQSRIDIQHSPGFISAPLSYAPVTSIFSGKAGSKET 171 LV + G L L+ + F R D+ H PGF++ P + S+ S G+K+T Sbjct: 84 LVWTCSGLL--LLSCSICLFWWAKRRDVLHMPGFLAGPCDMSKSVSLLSKHRGTKKT 138 >AF442729-1|AAL35294.1| 177|Homo sapiens MDAC1 protein. Length = 177 Score = 30.7 bits (66), Expect = 5.5 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +1 Query: 1 LVCSIQGRLAQLIFAAPSAFSHQSRIDIQHSPGFISAPLSYAPVTSIFSGKAGSKET 171 LV + G L L+ + F R D+ H PGF++ P + S+ S G+K+T Sbjct: 84 LVWTCSGLL--LLSCSICLFWWAKRRDVLHMPGFLAGPCDMSKSVSLLSKHRGTKKT 138 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,514,301 Number of Sequences: 237096 Number of extensions: 1735036 Number of successful extensions: 6089 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6025 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6089 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8511181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -