BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0377 (750 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q22EE6 Cluster: Hypothetical repeat containing protein;... 34 4.3 UniRef50_UPI0000587D3A Cluster: PREDICTED: hypothetical protein;... 33 5.7 >UniRef50_Q22EE6 Cluster: Hypothetical repeat containing protein; n=7; Tetrahymena thermophila SB210|Rep: Hypothetical repeat containing protein - Tetrahymena thermophila SB210 Length = 2413 Score = 33.9 bits (74), Expect = 4.3 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = -1 Query: 669 LVMNVHFRLVLHDIFRDNHIMQVAFSNNYQKKKMLILYVS 550 L+ VH+++ LH I+ + Q+ FS+ Y K+K++ L S Sbjct: 865 LIFVVHYQVDLHSIYTYQYESQITFSSQYDKEKVIQLLYS 904 >UniRef50_UPI0000587D3A Cluster: PREDICTED: hypothetical protein; n=2; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 177 Score = 33.5 bits (73), Expect = 5.7 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -1 Query: 729 NHSPSNILKTXSR*YYENKILVMNVHFRLVLHDIFRD 619 NHSP ++ + + YE K V +H R VL+D+FR+ Sbjct: 125 NHSPFSLTEAEVKALYEPKAKVQLLHTRDVLYDVFRE 161 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 630,228,621 Number of Sequences: 1657284 Number of extensions: 11594037 Number of successful extensions: 21379 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21377 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61734884250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -