BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0377 (750 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82094-3|CAB05024.1| 2561|Caenorhabditis elegans Hypothetical pr... 28 6.2 Z81120-8|CAB03348.1| 2561|Caenorhabditis elegans Hypothetical pr... 28 6.2 >Z82094-3|CAB05024.1| 2561|Caenorhabditis elegans Hypothetical protein T12D8.1 protein. Length = 2561 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Frame = +1 Query: 55 CSHCLYLFFLACV**HKRKNIGIECRIFFYTFFYMTVSMLKQSLLHINAFISL*C--IES 228 CS+C + CV H + ++ FFY F ++ S + +N F C + S Sbjct: 487 CSNCAQTYHTYCVTLHDKFRGILKSDFFFYKFDLISFSKSRIKKFRVNIFFQSVCHSVNS 546 Query: 229 ALEN 240 +L N Sbjct: 547 SLLN 550 >Z81120-8|CAB03348.1| 2561|Caenorhabditis elegans Hypothetical protein T12D8.1 protein. Length = 2561 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Frame = +1 Query: 55 CSHCLYLFFLACV**HKRKNIGIECRIFFYTFFYMTVSMLKQSLLHINAFISL*C--IES 228 CS+C + CV H + ++ FFY F ++ S + +N F C + S Sbjct: 487 CSNCAQTYHTYCVTLHDKFRGILKSDFFFYKFDLISFSKSRIKKFRVNIFFQSVCHSVNS 546 Query: 229 ALEN 240 +L N Sbjct: 547 SLLN 550 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,347,667 Number of Sequences: 27780 Number of extensions: 304351 Number of successful extensions: 594 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -