BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0377 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g46610.1 68418.m05738 hypothetical protein contains Pfam prof... 29 3.3 At1g59510.1 68414.m06682 expressed protein 28 7.6 >At5g46610.1 68418.m05738 hypothetical protein contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 543 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = -1 Query: 168 RHCHV---KKSVKENATLNAYIFPLVLSNTCQKEQIQTVTAIEALLSD 34 RHCH K VK + L + + +V + C K +IQT + L D Sbjct: 286 RHCHRFPWKHYVKVGSVLRQFGYTVVALHGCLKTEIQTPRPLRGLFKD 333 >At1g59510.1 68414.m06682 expressed protein Length = 381 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 41 SKASIAVTVCICSFWHVFDN-TRGKI*ALSVAF 136 +K+S+ +TVC+ ++H+F+ RG LS F Sbjct: 349 AKSSVIITVCLAVYFHIFNRFVRGPPVCLSQQF 381 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,768,160 Number of Sequences: 28952 Number of extensions: 254941 Number of successful extensions: 397 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -