BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0373 (662 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44879| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 >SB_44879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 352 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 364 VSTIWNYIVKRFYV*F*IFKRRFYCISVSPLLDLDISYNLIT 489 V TIW Y+ +FY+ K F+C + P + + +S ++ T Sbjct: 62 VLTIWFYVGVQFYIMSSRTKGIFFCRYIWPFMSVPLSVSIFT 103 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 140 FLPPWQHGLSPEGLPSPQAQL 78 ++PPW+ L P GLP P +L Sbjct: 1327 YVPPWELPLPPSGLPLPLPRL 1347 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,914,815 Number of Sequences: 59808 Number of extensions: 171592 Number of successful extensions: 325 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 323 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -