BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0373 (662 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor prot... 29 0.040 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 7.9 >S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor protein. Length = 85 Score = 29.1 bits (62), Expect = 0.040 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +1 Query: 439 ISVSPLLDLDISYNLITFNVLQLSLILSKYKKISTHNTH 555 + VS L+ L ISY LI FN+L +S +K I T +H Sbjct: 19 VIVSSLIIL-ISYALILFNILHMSSAEGWFKAIGTCGSH 56 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 73 RMCKRHRTPPCLRR 32 R+C HR PC+ R Sbjct: 1096 RLCLHHRDLPCVLR 1109 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,815 Number of Sequences: 438 Number of extensions: 1855 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -