BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0373 (662 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18560.1 68418.m02194 AP2 domain-containing transcription fac... 30 1.2 At4g31060.1 68417.m04410 AP2 domain-containing transcription fac... 29 3.6 At1g71520.1 68414.m08267 AP2 domain-containing transcription fac... 27 8.4 At1g28160.1 68414.m03456 ethylene-responsive element-binding fam... 27 8.4 At1g03800.1 68414.m00361 ERF domain protein 10 (ERF10) identical... 27 8.4 >At5g18560.1 68418.m02194 AP2 domain-containing transcription factor, putative AP2/EREBP-like transcription factor LEAFY PETIOLE, Arabidopsis thaliana, EMBL:AF216581 Length = 348 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 133 RPGSMACPRRACHLRRRSWGRMCKRHRTPPCLRRTWL 23 R A P R +RRR WGR R P R WL Sbjct: 45 RRSKQAEPGRFLGVRRRPWGRYAAEIRDPTTKERHWL 81 >At4g31060.1 68417.m04410 AP2 domain-containing transcription factor, putative TINY, Arabidopsis thaliana, PID:E218696 Length = 187 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 94 LRRRSWGRMCKRHRTPPCLRRTWL 23 +R+RSWG+ R P RR WL Sbjct: 30 VRKRSWGKWVSEIRVPKTGRRIWL 53 >At1g71520.1 68414.m08267 AP2 domain-containing transcription factor, putative Length = 143 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 94 LRRRSWGRMCKRHRTPPCLRRTWL 23 +RRR WG+ R P +R WL Sbjct: 17 IRRRKWGKWVSEIRVPGTRQRLWL 40 >At1g28160.1 68414.m03456 ethylene-responsive element-binding family protein contains similarity to ethylene-responsive element binding factor GI:8809573 from (Nicotiana sylvestris) Length = 245 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 Query: 94 LRRRSWGRMCKRHRTPPCLRRTWL 23 +RRR WGR R P R WL Sbjct: 42 VRRRPWGRYAAEIRNPTTKERYWL 65 >At1g03800.1 68414.m00361 ERF domain protein 10 (ERF10) identical to ERF domain protein 10 GI:11414990 from [Arabidopsis thaliana] Length = 245 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 94 LRRRSWGRMCKRHRTPPCLRRTWL 23 +RRR WGR R P +R WL Sbjct: 56 VRRRPWGRYAAEIRDPVKKKRVWL 79 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,264,415 Number of Sequences: 28952 Number of extensions: 111753 Number of successful extensions: 311 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 311 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -