BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0367 (745 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC959.05c |||protein disulfide isomerase |Schizosaccharomyces ... 28 1.6 SPBC609.01 |||ribonuclease II |Schizosaccharomyces pombe|chr 2||... 25 8.6 >SPAC959.05c |||protein disulfide isomerase |Schizosaccharomyces pombe|chr 1|||Manual Length = 632 Score = 27.9 bits (59), Expect = 1.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 147 AMLDALGLILYRPNSTQLQVLRNSGKCKSAA 239 ++ L +IL PNS++LQ LR G C + + Sbjct: 544 SLFSTLRIILEHPNSSRLQKLRAPGLCPNGS 574 >SPBC609.01 |||ribonuclease II |Schizosaccharomyces pombe|chr 2|||Manual Length = 1157 Score = 25.4 bits (53), Expect = 8.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 168 LILYRPNSTQLQVLRNSGKCKSAAAGENG 254 L LYRPNS L+ + + S ++GE G Sbjct: 467 LALYRPNSLALKNQSSHRRNSSTSSGETG 495 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,998,320 Number of Sequences: 5004 Number of extensions: 25317 Number of successful extensions: 50 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -