BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0366 (364 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Sc... 25 2.7 SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual 25 4.8 SPCC645.13 |||transcription elongation regulator|Schizosaccharom... 25 4.8 SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subuni... 24 6.3 >SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 25.4 bits (53), Expect = 2.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 119 ADKHCVXPTLATSGSRPCYKLXTHNIVYVF 208 A KHC + +G +PC T NI V+ Sbjct: 38 ACKHCRQKKIKCNGGQPCISCKTLNIECVY 67 >SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual Length = 1339 Score = 24.6 bits (51), Expect = 4.8 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 187 TQYCLCFLFVSLYL--KLTFSSAFNLVTTCKSNLIDQGV 297 T LC ++S Y KL S FNL+++ SNL + V Sbjct: 242 TVLILCSTYISTYSYSKLAQSVIFNLISSPVSNLAFENV 280 >SPCC645.13 |||transcription elongation regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 721 Score = 24.6 bits (51), Expect = 4.8 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -1 Query: 172 TWSRSRCCQCWXYTMLVGL 116 TW + C CW + VGL Sbjct: 34 TWVQCDGCDCWQHASCVGL 52 >SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subunit a Pol2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 2199 Score = 24.2 bits (50), Expect = 6.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 262 LRD*MQKKMLILNRGKQTKNIDNI 191 L D +QK++ +LN Q K ID+I Sbjct: 1161 LPDWLQKRVAVLNSKYQQKKIDSI 1184 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,324,562 Number of Sequences: 5004 Number of extensions: 23202 Number of successful extensions: 61 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 112046990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -