BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0364 (785 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50300-6|AAC48109.1| 642|Caenorhabditis elegans Hypothetical pr... 28 8.7 AF101312-4|AAC69220.1| 358|Caenorhabditis elegans Hypothetical ... 28 8.7 >U50300-6|AAC48109.1| 642|Caenorhabditis elegans Hypothetical protein R03H4.1 protein. Length = 642 Score = 27.9 bits (59), Expect = 8.7 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 5/33 (15%) Frame = -1 Query: 476 IARYPHYN----NGFLDY-IKNDKDIENLHLNR 393 + +P YN N FL Y I+N ++E+LHLNR Sbjct: 531 LGSHPLYNINHLNTFLHYLIQNSDELESLHLNR 563 >AF101312-4|AAC69220.1| 358|Caenorhabditis elegans Hypothetical protein F56E10.1 protein. Length = 358 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -3 Query: 246 RKCTKLLQKHLPNA*RKEKKS*RGRALDDVCCLRSMEPELS 124 R KL +K + NA KEK+ + + +C + + EP S Sbjct: 168 RNLAKLCEKEVENADEKEKEQLKSEEIQHLCQVLAYEPNSS 208 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,887,160 Number of Sequences: 27780 Number of extensions: 285349 Number of successful extensions: 701 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 700 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1903721438 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -