BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0362 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 24 1.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 4.0 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 7.1 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 24.2 bits (50), Expect = 1.3 Identities = 8/35 (22%), Positives = 22/35 (62%) Frame = +2 Query: 137 NLLCIYFYVQQEKKLLIHIQYFDWPLLDITLSLAM 241 ++L +FYVQ++ + + + F W ++ + + +A+ Sbjct: 376 SILVPFFYVQEDDDVKLVLLNFGWQMICLIVVIAL 410 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 131 SFNLLCIYFYVQQEKKLLIHIQYFDW 208 S LL +Y+++ L H++ FDW Sbjct: 262 SHKLLLNRYYLERLSNDLPHLEEFDW 287 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 742 SPHHSYXTEFKNSTTHFQHNILN 674 SPHH Y ++ T +N LN Sbjct: 524 SPHHEYYDSKSSTETPPSYNQLN 546 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,563 Number of Sequences: 438 Number of extensions: 3773 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -