BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0361 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 2.3 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 3.0 CR954257-15|CAJ14166.1| 271|Anopheles gambiae predicted protein... 24 5.3 Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein prot... 23 7.0 AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-tran... 23 7.0 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.0 bits (52), Expect = 2.3 Identities = 27/109 (24%), Positives = 47/109 (43%), Gaps = 2/109 (1%) Frame = +2 Query: 245 KNVILTGVKSVCLLDNEKLKQIDLYSQFLCPPDKIGVNRAEGSLERARGLNPMVDVTSHT 424 K V L G ++N K K++ YS+ +++ R + + + L P+ +HT Sbjct: 1831 KAVQLPGGAVRVTIENAKGKKVAKYSKVGSYENRLSTWRYGSNDKLQQELPPIYHYRAHT 1890 Query: 425 KGVDELPDSFFTEFDVVCATGLKQEQFERIN--NACRDSNKKFICGDVW 565 ++ +P FF L+Q+ R N NA R K+ G +W Sbjct: 1891 STMENVP--FFVANYTSEQMQLQQQWEVRYNYDNANRLIRKRTPDGGIW 1937 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/46 (19%), Positives = 25/46 (54%) Frame = +2 Query: 80 TALQKMVGNNEVELSEAEAEQYDRQIRLWGLDSQKRLRAAKVLIIG 217 T ++G++ ++ + D+Q+ LW ++R++ + +I+G Sbjct: 543 TTFSNIIGSSGPSVTSCTGSEIDKQVGLW----ERRVKGLRRMILG 584 >CR954257-15|CAJ14166.1| 271|Anopheles gambiae predicted protein protein. Length = 271 Score = 23.8 bits (49), Expect = 5.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 376 QRTLCSIYADLVRRTQKLG 320 QRT + Y +LVRRTQ G Sbjct: 3 QRTTMARYPELVRRTQGRG 21 >Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein protein. Length = 209 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -2 Query: 393 KPRALSNEPSARFTPILSGGHRNWEYRSIC 304 KP L P ++ G WE R+IC Sbjct: 40 KPEFLKINPQHCIPTLVDNGFALWESRAIC 69 >AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -2 Query: 393 KPRALSNEPSARFTPILSGGHRNWEYRSIC 304 KP L P ++ G WE R+IC Sbjct: 40 KPEFLKINPQHCIPTLVDNGFALWESRAIC 69 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,636 Number of Sequences: 2352 Number of extensions: 12742 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -