BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0357 (750 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces... 29 0.94 SPAPB2C8.01 |||glycoprotein |Schizosaccharomyces pombe|chr 1|||M... 25 8.7 SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 comple... 25 8.7 SPAC23H4.01c ||SPAP27G11.01|sterol binding ankyrin repeat protei... 25 8.7 >SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1727 Score = 28.7 bits (61), Expect = 0.94 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 559 VLSTNIRYEADYWQITGGRTSC 624 +LST +R EA Y Q+T RT C Sbjct: 463 LLSTKMRQEACYLQLTASRTQC 484 >SPAPB2C8.01 |||glycoprotein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1220 Score = 25.4 bits (53), Expect = 8.7 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +1 Query: 523 FYSYILHRRIQNVLSTNIRYEA-DYWQITGGRTSCES*RVGT 645 FY + + I +TN Y+A YW +T G+T S +GT Sbjct: 1121 FYGWFGDKAISGWSNTN--YDAYAYWHVTTGQTGMGSFSMGT 1160 >SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 442 Score = 25.4 bits (53), Expect = 8.7 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -2 Query: 158 KLHKYENARN*IKIPILFSL*CVPSDKFLLFVLSLFYTKLCLLFID*GTTK 6 + H Y+ + K +LFS P + + LSL Y CLL + TK Sbjct: 232 RCHLYQRKIHQAKDHLLFSFLQCPDECYHQKRLSLIYLTTCLLILGKSPTK 282 >SPAC23H4.01c ||SPAP27G11.01|sterol binding ankyrin repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 945 Score = 25.4 bits (53), Expect = 8.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 219 AGPIWLLLVLNYLWKSRE 166 +GPIW L N W+SRE Sbjct: 917 SGPIWQLKKENNYWESRE 934 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,746,890 Number of Sequences: 5004 Number of extensions: 52283 Number of successful extensions: 100 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -