BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0352 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48913| Best HMM Match : TSP_1 (HMM E-Value=1.8e-11) 29 4.3 SB_35522| Best HMM Match : AT_hook (HMM E-Value=7.3) 28 5.7 >SB_48913| Best HMM Match : TSP_1 (HMM E-Value=1.8e-11) Length = 1068 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -3 Query: 336 AVCSSA-YTAKQKTINLTCGQSATVRTVCCAVECTLGAGSPHARSSSGNSFSRHRPT 169 A C+++ YT + + TCG+ R+V C E GS ++ S ++ + ++PT Sbjct: 742 ATCTASWYTTEWSPCSATCGKGTQSRSVICRRETF--TGSMQYKTLSDSNCAENKPT 796 >SB_35522| Best HMM Match : AT_hook (HMM E-Value=7.3) Length = 250 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 24 LLRTKPRGRPPSCCREL*EIKSFPCTVRPMKLSEFCSRIS 143 L+ K RGR PS ++ +FP T +LS +CSR+S Sbjct: 11 LVAKKRRGRTPSIRKQ-----NFPLTSNKNRLSCYCSRVS 45 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,490,776 Number of Sequences: 59808 Number of extensions: 356181 Number of successful extensions: 996 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 996 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -