BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0348 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 27 0.21 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 8.0 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 26.6 bits (56), Expect = 0.21 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = +2 Query: 266 EYMKYIGFKSVDNEFTYP----KEXXXSKLRMAQVAIERKLHFCCGSVPIXPI 412 EY + GF +D ++ YP KE + LR + A + K H +V PI Sbjct: 131 EYFEKYGFNGLDIDWEYPEAKDKENFITLLREIKEAFQPKGHLLTIAVSAIPI 183 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 203 YELRSIKKNVFKDLSKLDSFN 265 Y+LR ++KN +D+FN Sbjct: 217 YDLRRVRKNYNSICELVDAFN 237 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,982 Number of Sequences: 336 Number of extensions: 3021 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -