BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0345 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 24 1.5 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 1.5 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 2.0 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 22 6.0 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 6.0 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 8.0 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 505 PSYLPRSHSWSPVSLL*RSCWPASTPRPVTKW 600 PS P S P+SL+ R C + +P W Sbjct: 218 PSQSPEPESVRPLSLVVRRCEEPTEEKPWRPW 249 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 512 TCQDLTPGRRYHCSEEAAG 568 TC+D+ R HCS+ +G Sbjct: 160 TCEDIGNSHRCHCSDGYSG 178 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 15 IGVAWAMPAAEQDSDPNILGSVLGVVKECVDGDVTL 122 + +AW P + + LGS+ VK+ V GD L Sbjct: 151 LDLAWEFPENKPKKIRSKLGSIWHSVKKTVAGDKVL 186 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 220 PGLPGPWSHCPRS 258 PG PGP S P S Sbjct: 92 PGTPGPLSQAPAS 104 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 220 PGLPGPWSHCPRS 258 PG PGP S P S Sbjct: 248 PGTPGPLSQAPAS 260 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +3 Query: 189 DGVTLDSKGSPRSARALEPLPEEPKAREAQVESRLV 296 D ++D++ PR+A E L EP + E R++ Sbjct: 527 DSASVDTRLWPRAAALGEVLWSEPTNTWREAEQRIL 562 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,749 Number of Sequences: 336 Number of extensions: 2701 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -