BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0339 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 30 0.027 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 7.1 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 7.1 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 7.1 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 7.1 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 29.9 bits (64), Expect = 0.027 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +1 Query: 238 VGVQPTQERSSQAEDPVDSEAKEPGERPPERLSESSNQRVHNRKT 372 VGVQP Q+ ++ A+ P+D AK P +S Q++ R T Sbjct: 497 VGVQPHQDSATPADQPLDLSAK-PKNSQDNNISLLEQQKIPLRMT 540 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = +1 Query: 406 IPGEQDVKEVVQSSDERVANSQTQLNFSMVNVGANY 513 +PG D +V E A T ++ + V NY Sbjct: 343 VPGNHDQLRLVSRFGEEKARMITTMSLLLPGVAVNY 378 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 132 EVALVEGLQQVVEGA 88 ++ LVEGL++ EGA Sbjct: 236 QIKLVEGLEEEAEGA 250 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = +1 Query: 406 IPGEQDVKEVVQSSDERVANSQTQLNFSMVNVGANY 513 +PG D +V E A T ++ + V NY Sbjct: 343 VPGNHDQLRLVSRFGEEKARMITTMSLLLPGVAVNY 378 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 132 EVALVEGLQQVVEGA 88 ++ LVEGL++ EGA Sbjct: 326 QIKLVEGLEEEAEGA 340 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.313 0.129 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,658 Number of Sequences: 438 Number of extensions: 2922 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -