BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0337 (632 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 27 0.49 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 2.6 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 23 8.1 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 27.1 bits (57), Expect = 0.49 Identities = 24/134 (17%), Positives = 54/134 (40%) Frame = +1 Query: 94 QLKGPAXVLKRNFKHLAVDIRMVNPRLLKVEKWFGSKKELAAVRTVCSHVENMIKGVTKG 273 QLKG ++ + ++ + + ++E + EL T + M++ + K Sbjct: 911 QLKGKIHTTEKRIRLVSATQDKLEDVVEELEGKNRERDELIRYSTALRDLTQMMRDIRKS 970 Query: 274 FQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNSPKQKDELIIE 453 + + H + V + +I++IRN+LG+ + + + ++VV + Sbjct: 971 RFSHLHKLTTHMALR-VKHKFTNIMQIRNYLGKLRVNQEECRLSLSVVPRDANVQNAVST 1029 Query: 454 GNSLEDVSSSAALI 495 SL S A + Sbjct: 1030 TKSLSGGERSYATV 1043 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.6 bits (51), Expect = 2.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 251 MFSTCEQTVLTAASSFLDPN 192 M S CE+T+ SSF DP+ Sbjct: 327 MISACEKTMQRMTSSFPDPH 346 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 23.0 bits (47), Expect = 8.1 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 347 LRYVTSWVRNTSEG 388 +RY+ SWV N + G Sbjct: 84 VRYINSWVHNQTHG 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 623,897 Number of Sequences: 2352 Number of extensions: 12491 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -