BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0335 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 24 1.2 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 6.4 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 6.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.5 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.2 bits (50), Expect = 1.2 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +3 Query: 45 RTKSCSPSPEIKSTAVVKYTAFQSPVG-YARLQCNTDLNMPPSNWGA 182 R+ + SPSP + + TA +SP G LQC T N + W A Sbjct: 739 RSPNASPSPAEQCASTTTITA-RSPQGSQGLLQCATS-NYSTTRWPA 783 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 130 LVYSVTPISTCHRLTGEQP 186 L+YSV PIS + L +P Sbjct: 383 LLYSVLPISVANELRHSRP 401 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 130 LVYSVTPISTCHRLTGEQP 186 L+YSV PIS + L +P Sbjct: 383 LLYSVLPISVANELRHSRP 401 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 77 DLWRGTARLSSLLFIIVVCFFHF 9 D W R LFI +VCF + Sbjct: 405 DEWPRLLRKRKELFIAIVCFVSY 427 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 77 DLWRGTARLSSLLFIIVVCFFHF 9 D W R LFI +VCF + Sbjct: 458 DEWPRLLRKRKELFIAIVCFVSY 480 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,525 Number of Sequences: 438 Number of extensions: 2997 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -