BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0332 (824 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) 421 e-118 SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) 30 2.0 SB_49186| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_11242| Best HMM Match : MAM (HMM E-Value=0) 29 6.1 >SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 421 bits (1037), Expect = e-118 Identities = 187/253 (73%), Positives = 220/253 (86%) Frame = +1 Query: 7 KHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNEVLKIVK 186 KH+KRLNAPK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYAL G EV KIVK Sbjct: 431 KHMKRLNAPKHWMLDKLSGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALNGEEVKKIVK 490 Query: 187 QRLIKVDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKV 366 QRLIK+DGKVRTD TYPAGFMDVV+I+KT E FRL+YDVKGRF +HRIT EEAKYKL +V Sbjct: 491 QRLIKIDGKVRTDTTYPAGFMDVVTIDKTGENFRLLYDVKGRFAVHRITAEEAKYKLGRV 550 Query: 367 KRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIATTKIMDFIKFESGNLCMITGG 546 +RV G K VPY+VTHD RTIRYPDP IKVND++ +DI T K++D+IKF++GN+ M+ GG Sbjct: 551 RRVDVGAKGVPYIVTHDARTIRYPDPNIKVNDTVVIDIKTGKVIDYIKFDTGNMAMVVGG 610 Query: 547 RNLGRVGTIVSRERHPGSFDIVHIKDSTGHTFATRLNNVFIIGKGTKAYISLPRGKGIRL 726 RN+GRVG + RE+H GSFDIVH+KD+TGH FATRL N+F+IGKG K Y+SLP+GKG+RL Sbjct: 611 RNMGRVGMVTHREKHAGSFDIVHVKDATGHQFATRLTNIFVIGKGNKPYVSLPKGKGVRL 670 Query: 727 TXAEERDKRIXXK 765 + AEERD+RI K Sbjct: 671 SIAEERDRRIAEK 683 >SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) Length = 482 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/72 (23%), Positives = 35/72 (48%) Frame = +1 Query: 319 IHRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIATTKIM 498 I +TP+ K C+V R++TGP +++ +G + +++ ++ + + + Sbjct: 287 IRMVTPQGTVEKSCQVPRMSTGPDLHHFIMGSEGTLGVITEVTLRIRPVPEIRVYGSVV- 345 Query: 499 DFIKFESGNLCM 534 F FE G CM Sbjct: 346 -FPDFEKGVACM 356 >SB_49186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1776 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/56 (19%), Positives = 28/56 (50%) Frame = +1 Query: 145 KYALTGNEVLKIVKQRLIKVDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGR 312 +Y L ++ + + L++ G + P+YP+ ++ ++ +N+LF + R Sbjct: 596 EYWLMASQGQHVSESTLVRGRGDILISPSYPSALLETTTLITSNQLFNTFIESSTR 651 >SB_11242| Best HMM Match : MAM (HMM E-Value=0) Length = 348 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 2/20 (10%) Frame = +3 Query: 132 EES--SEVCFDRKRSPENCE 185 EES +E+C DRKR P++CE Sbjct: 76 EESRYNELCHDRKRGPDDCE 95 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,116,313 Number of Sequences: 59808 Number of extensions: 631343 Number of successful extensions: 1991 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1983 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2311562737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -